We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

nNOS Recombinant Protein Antigen

Images

 
There are currently no images for nNOS Recombinant Protein Antigen (NBP3-21327PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

nNOS Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human nNOS

Source: E.coli

Amino Acid Sequence: DHLGVFPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGVISNWTDELRLPPCTIFQAFKYYLD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NOS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21327. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for nNOS Recombinant Protein Antigen

  • bNOS
  • brain
  • Constitutive NOS
  • EC 1.14.13.39
  • IHPS1
  • Neuronal NOS
  • nitric oxide synthase 1 (neuronal)
  • nNOS
  • N-NOS
  • nNOSNOS type I
  • NOS
  • NOS1
  • Peptidyl-cysteine S-nitrosylase NOS1

Background

NOS (nitric oxide synathase) is a mediator of NO (nitric oxide) production, an inorganic gaseous messenger between cells. In cells, NOS catalyzes the oxidization of L-arginine to produce L-citrulline and NO. Three isoforms of NOS has been identified (eNOS, iNOS, and nNOS) with all of them having binding sites for NADPH, FAD, FMN, and tetrahydrobiopterin (1). Specifically, nNOS (Neuronal nitric oxide synthase bNOS, cNOS, Type I) is bound to PSD95 located in the neuronal membrane and at increased level of Ca2+, nNOS is trasnlocated to cytoplasm. In cytoplasm, nNOS is dephosphorylated by calcineurin which initiates NO production (2). A phosphorylation by PKA and PKC on nNOS leads down-regulation of NO production.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr,  IHC-P, WB
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-76370
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP1-76919
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-82390
Species: Hu
Applications: ELISA
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
DVE00
Species: Hu
Applications: ELISA
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
NBP3-21327PEP
Species: Hu
Applications: AC

Publications for nNOS Recombinant Protein Antigen (NBP3-21327PEP) (0)

There are no publications for nNOS Recombinant Protein Antigen (NBP3-21327PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for nNOS Recombinant Protein Antigen (NBP3-21327PEP) (0)

There are no reviews for nNOS Recombinant Protein Antigen (NBP3-21327PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for nNOS Recombinant Protein Antigen (NBP3-21327PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional nNOS Products

Research Areas for nNOS Recombinant Protein Antigen (NBP3-21327PEP)

Find related products by research area.

Blogs on nNOS

There are no specific blogs for nNOS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

nNOS Antibody
NB100-858

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our nNOS Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NOS1