NMRAL1 Antibody - Azide and BSA Free

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NMRAL1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit NMRAL1 Antibody - Azide and BSA Free (NBP3-04825) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 200-299 of human NMRAL1 (NP_065728.1). LLKMPEKYVGQNIGLSTCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYALRPDRDIELTLRLNPKALTLDQWLEQHKGDFNLL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NMRAL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for NMRAL1 Antibody - Azide and BSA Free

• HSCARGFLJ25918
• NmrA-like family domain containing 1
• nmrA-like family domain-containing protein 1
• SDR48A1
• short chain dehydrogenase/reductase family 48A, member 1

Background

Redox sensor protein. Undergoes restructuring and subcellular redistribution in response to changes inintracellular NADPH/NADP(+) levels. At low NADPH concentrations the protein is found mainly as a monomer, and bindsargininosuccinate synthase (ASS1), the enzyme involved in nitric oxide synthesis. Association with ASS1 impairs itsactivity and reduces the production of nitric oxide, which subsecuently prevents apoptosis. Under normal NADPHconcentrations, the protein is found as a dimer and hides the binding site for ASS1. The homodimer binds one moleculeof NADPH. Has higher affinity for NADPH than for NADP(+). Binding to NADPH is necessary to form a stable dimer

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: NMRAL1