Novus Biologicals products are now on bio-techne.com

NME3 Antibody

Images

 
Western Blot: NME3 Antibody [H00004832-D01P] - Analysis of NME3 expression in transfected 293T cell line by NME3 polyclonal antibody.Lane 1: NME3 transfected lysate(19.00 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NME3 Antibody Summary

Description
Quality control test: Antibody reactive against mammalian transfected lysate.
Immunogen
NME3 (NP_002504.2, 1 a.a. - 169 a.a.) full-length human protein. MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE
Specificity
NME3 - non-metastatic cells 3, protein expressed in,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NME3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NME3 Antibody

  • c371H6.2
  • DR-nm23NDPK-C
  • EC 2.7.4.6
  • KIAA0516
  • NDK 3
  • NDP kinase 3
  • NDP kinase C
  • NDPKC
  • NM23H3
  • NM23-H3
  • non-metastatic cells 3, protein expressed in
  • nucleoside diphosphate kinase 3
  • Nucleoside diphosphate kinase C

Background

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Probably has a role in normal hematopoiesis by inhibition of granulocyte differentiation and induction of apoptosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80992
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02487
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00004831-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
3014-NR
Species: Hu
Applications: BA
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DGB300
Species: Hu
Applications: ELISA
AF3968
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
NBP1-90222
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-93423
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-74359
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-89102
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB6896
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
H00004832-D01P
Species: Hu
Applications: WB

Publications for NME3 Antibody (H00004832-D01P) (0)

There are no publications for NME3 Antibody (H00004832-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NME3 Antibody (H00004832-D01P) (0)

There are no reviews for NME3 Antibody (H00004832-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NME3 Antibody (H00004832-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NME3 Products

Research Areas for NME3 Antibody (H00004832-D01P)

Find related products by research area.

Blogs on NME3

There are no specific blogs for NME3, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NME3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NME3
Entrez
Uniprot