NMDAR3B Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 180-410 of human GRIN3B (NP_619635.1). RTQDPGGLVALWTSRAGRPPQLVLDLSRRDTGDAGLRARLAPMAAPVGGEAPVPAAVLLGCDIARARRVLEAVPPGPHWLLGTPLPPKALPTAGLPPGLLALGEVARPPLEAAIHDIVQLVARALGSAAQVQPKRALLPAPVNCGDLQPAGPESPGRFLARFLANTSFQGRTGPVWVTGSSQVHMSRHFKVWSLRRDPRGAPAWATVGSWRDGQLDLEPGGASARPPPPQG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GRIN3B |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Western Blot 1:500-1:1000
|
| Theoretical MW |
112 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for NMDAR3B Antibody - BSA Free
Background
The GRIN3B (NMDAR3B) gene encodes a 1,043 amino acid long, nearly 113 kDA glutamate receptor iontrophic, NMDA 3B that is a glycine controlled receptor that functions in glutamate-gated ion channels with reduced single-channel conductance, calcium, and voltage-sensitivity to magnesium. GRIN3B functions in glutamic acid signaling, the pathogenesis of ALS, the neuroactive ligand-receptor interaction, and the dopamine DARPP32 feedback onto cAMP pathway. This gene has been linked to HIV type 1, neuroblastoma, pain syndrome, opiod abuse, immunodeficiency, and alzheimer's disease.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Mu, Rb, Rt
Applications: IHC, IHC-P, IP, KO, WB
Species: Hu, Mu, Rt
Applications: IP, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: ICC, IHC, Simple Western, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Rt
Applications: WB, ELISA
Publications for NMDAR3B Antibody (NBP2-94574) (0)
There are no publications for NMDAR3B Antibody (NBP2-94574).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NMDAR3B Antibody (NBP2-94574) (0)
There are no reviews for NMDAR3B Antibody (NBP2-94574).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NMDAR3B Antibody (NBP2-94574) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NMDAR3B Products
Research Areas for NMDAR3B Antibody (NBP2-94574)
Find related products by research area.
|
Blogs on NMDAR3B