Recombinant Human NMDAR2B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NMDAR2B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human GRIN2B partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GRIN2B

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NMDAR2B Protein

  • glutamate [NMDA] receptor subunit epsilon-2
  • glutamate receptor subunit epsilon-2
  • glutamate receptor, ionotropic, N-methyl D-aspartate 2B
  • hNR3
  • MGC142180
  • NMDAR2BMGC142178
  • N-methyl D-aspartate receptor subtype 2B
  • N-methyl-D-aspartate receptor subunit 3
  • NR2B
  • NR3

Background

GRIN2B - glutamate receptor, ionotropic, N-methyl D-aspartate 2B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-105
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P, IP
NB300-118
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP, IF
NBP2-45856
Species: Hu
Applications: WB, IHC, IF
NB300-107
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
AF2180
Species: Hu
Applications: WB, Simple Western, IP
36340002
Species: Hu
Applications: WB, ELISA
PPS007
Species: Hu, Mu, Rt, Ca, Ch
Applications: WB
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
PPS050
Species: Hu, Mu, Rt, Ch, Pm, Ze
Applications: WB
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2685
Species: Hu
Applications: WB, Simple Western, IHC

Publications for NMDAR2B Partial Recombinant Protein (H00002904-Q01) (0)

There are no publications for NMDAR2B Partial Recombinant Protein (H00002904-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NMDAR2B Partial Recombinant Protein (H00002904-Q01) (0)

There are no reviews for NMDAR2B Partial Recombinant Protein (H00002904-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NMDAR2B Partial Recombinant Protein (H00002904-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NMDAR2B Products

Bioinformatics Tool for NMDAR2B Partial Recombinant Protein (H00002904-Q01)

Discover related pathways, diseases and genes to NMDAR2B Partial Recombinant Protein (H00002904-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NMDAR2B Partial Recombinant Protein (H00002904-Q01)

Discover more about diseases related to NMDAR2B Partial Recombinant Protein (H00002904-Q01).
 

Pathways for NMDAR2B Partial Recombinant Protein (H00002904-Q01)

View related products by pathway.

PTMs for NMDAR2B Partial Recombinant Protein (H00002904-Q01)

Learn more about PTMs related to NMDAR2B Partial Recombinant Protein (H00002904-Q01).
 

Research Areas for NMDAR2B Partial Recombinant Protein (H00002904-Q01)

Find related products by research area.

Blogs on NMDAR2B

There are no specific blogs for NMDAR2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF
NMDAR2B Antibody
NB300-106-100ul

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NMDAR2B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GRIN2B