NMDAR2B Antibody (2G5)

Images

 
Sandwich ELISA: NMDAR2B Antibody (2G5) [H00002904-M01] - Detection limit for recombinant GST tagged GRIN2B is approximately 3ng/ml as a capture antibody.
Proximity Ligation Assay: NMDAR2B Antibody (2G5) [H00002904-M01] - Analysis of protein-protein interactions between CAPN1 and GRIN2B. HeLa cells were stained with anti-CAPN1 rabbit purified polyclonal 1:1200 and ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PLA
Clone
2G5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NMDAR2B Antibody (2G5) Summary

Immunogen
GRIN2B (NP_000825 127 a.a. - 236 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEE
Specificity
GRIN2B - glutamate receptor, ionotropic, N-methyl D-aspartate 2B (2G5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GRIN2B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NMDAR2B Antibody (2G5)

  • glutamate [NMDA] receptor subunit epsilon-2
  • glutamate receptor subunit epsilon-2
  • glutamate receptor, ionotropic, N-methyl D-aspartate 2B
  • hNR3
  • MGC142180
  • NMDAR2BMGC142178
  • N-methyl D-aspartate receptor subtype 2B
  • N-methyl-D-aspartate receptor subunit 3
  • NR2B
  • NR3

Background

N-methyl-D-aspartate (NMDA) receptors are a class of ionotropic glutamate receptors. NMDA receptor channel has been shown to be involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. NMDA receptor channels are heteromers composed of three different subunits: NR1 (GRIN1), NR2 (GRIN2A, GRIN2B, GRIN2C, or GRIN2D) and NR3 (GRIN3A or GRIN3B). The NR2 subunit acts as the agonist binding site for glutamate. This receptor is the predominant excitatory neurotransmitter receptor in the mammalian brain. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-105
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P, IP
NB300-118
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP, IF
NBP2-45856
Species: Hu
Applications: WB, IHC, IF
NB300-107
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
AF2180
Species: Hu
Applications: WB, Simple Western, IP
36340002
Species: Hu
Applications: WB, ELISA
PPS007
Species: Hu, Mu, Rt, Ca, Ch
Applications: WB
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
PPS050
Species: Hu, Mu, Rt, Ch, Pm, Ze
Applications: WB
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2685
Species: Hu
Applications: WB, Simple Western, IHC

Publications for NMDAR2B Antibody (H00002904-M01) (0)

There are no publications for NMDAR2B Antibody (H00002904-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NMDAR2B Antibody (H00002904-M01) (0)

There are no reviews for NMDAR2B Antibody (H00002904-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NMDAR2B Antibody (H00002904-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NMDAR2B Products

Bioinformatics Tool for NMDAR2B Antibody (H00002904-M01)

Discover related pathways, diseases and genes to NMDAR2B Antibody (H00002904-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NMDAR2B Antibody (H00002904-M01)

Discover more about diseases related to NMDAR2B Antibody (H00002904-M01).
 

Pathways for NMDAR2B Antibody (H00002904-M01)

View related products by pathway.

PTMs for NMDAR2B Antibody (H00002904-M01)

Learn more about PTMs related to NMDAR2B Antibody (H00002904-M01).
 

Research Areas for NMDAR2B Antibody (H00002904-M01)

Find related products by research area.

Blogs on NMDAR2B

There are no specific blogs for NMDAR2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NMDAR2B Antibody (2G5) and receive a gift card or discount.

Bioinformatics

Gene Symbol GRIN2B
Entrez
Uniprot