Recombinant Human NMDAR1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human NMDAR1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 21-120 of Human NMDAR1

Source: Wheat Germ

Amino Acid Sequence: ACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQLNATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
GRIN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NMDAR1 Protein

  • glutamate [NMDA] receptor subunit zeta-1
  • glutamate receptor, ionotropic, N-methyl D-aspartate 1
  • NMDA1
  • NMDAR1glutamate [NMDA] receptor subunit zeta 1
  • NMD-R1
  • N-methyl-D-aspartate receptor channel, subunit zeta-1
  • N-methyl-D-aspartate receptor subunit NR1
  • NR1

Background

The protein encoded by this gene is a critical subunit of N-methyl-D-aspartate receptors, members of the glutamate receptor channel superfamily which are heteromeric protein complexes with multiple subunits arranged to form a ligand-gated ion channel. These subunits play a key role in the plasticity of synapses, which is believed to underlie memory and learning. The gene consists of 21 exons and is alternatively spliced, producing transcript variants differing in the C-terminus. Although the sequence of exon 5 is identical in human and rat, the alternative exon 5 splicing in rat has yet to be demonstrated in human. Cell-specific factors are thought to control expression of different isoforms, possibly contributing to the functional diversity of the subunits.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-106
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-19551
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-171
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NB300-107
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP1-88191
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-64698
Species: Hu
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP1-02312
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, ICC
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-88227
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
H00116443-R01
Species: Hu
NLS3208
Species: Hu, Po, Bv, Eq, Mk, Pm
Applications: WB, IHC-P, ICC
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-46198
Species: Hu
Applications: WB, IHC
H00002902-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for NMDAR1 Partial Recombinant Protein (H00002902-Q01) (0)

There are no publications for NMDAR1 Partial Recombinant Protein (H00002902-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NMDAR1 Partial Recombinant Protein (H00002902-Q01) (0)

There are no reviews for NMDAR1 Partial Recombinant Protein (H00002902-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NMDAR1 Partial Recombinant Protein (H00002902-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for NMDAR1 Partial Recombinant Protein (H00002902-Q01)

Discover related pathways, diseases and genes to NMDAR1 Partial Recombinant Protein (H00002902-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NMDAR1 Partial Recombinant Protein (H00002902-Q01)

Discover more about diseases related to NMDAR1 Partial Recombinant Protein (H00002902-Q01).
 

Pathways for NMDAR1 Partial Recombinant Protein (H00002902-Q01)

View related products by pathway.

PTMs for NMDAR1 Partial Recombinant Protein (H00002902-Q01)

Learn more about PTMs related to NMDAR1 Partial Recombinant Protein (H00002902-Q01).
 

Research Areas for NMDAR1 Partial Recombinant Protein (H00002902-Q01)

Find related products by research area.

Blogs on NMDAR1

There are no specific blogs for NMDAR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NMDAR1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GRIN1