NKRF Antibody

Western Blot: NKRF Antibody [NBP3-10499] - Western blot analysis using NBP3-10499 on Human Muscle as a positive control. Antibody Titration: 0.2-1 ug/ml

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

NKRF Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NKRF (NP_060014). Peptide sequence QKYGLKSKSHGVGHDRYLVVGRKRRKEDLLDQLKQEGQVGHYELVMPQAN
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NKRF
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot 1.0 ug/ml
• Theoretical MW: 78 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS buffer, 2% sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for NKRF Antibody

• ITBA4NFkB-repressing factor
• NF-kappaB repressing factor
• NFKB repressing factor
• NRFNF-kappa-B-repressing factor
• Protein ITBA4
• Transcription factor NRF

Background

The NKRF gene encodes a transcription factor that interacts with specific negative regulatory elements (NREs) to mediatetranscriptional repression of certain NK-kappa-B-responsive genes. The protein localizes predominantly to thenucleolus with a small fractio

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NKRF