NKp46/NCR1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NKp46/NCR1. Source: E. coli Amino Acid Sequence: TLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVT Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
NCR1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58055. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for NKp46/NCR1 Recombinant Protein Antigen
Background
NKp46 (also known as natural cytotoxicity receptor 1, NCR1), is a ~46 kDa Type 1 transmembrane protein and a member of the immunoglobulin superfamily (1). NKp46 is highly conserved in mammals and can be characterized by two extracellular C2-type Ig-like domains followed by a stalk region (1). NKp46 is expressed by activated and resting natural killer (NK) cells, innate lymphoid cell (ILC) 1, and a small population of T lymphocytes (1). NKp46, along with NKp30 and NKp44, are activating receptors that have been collectively termed the natural cytotoxicity receptors (NCRs) (2). The NKp46 and NKp30 receptors play a major role in triggering some of the key lytic activities of NK cells (2). NKp46 is the only cytotoxicity receptor with a mouse orthologue, known as mNKp46 (2).
NKp46 plays a critical role in the NK-cell lysis of allogenic, autologous, and xenogeneic cells (3). Activation of NKp46 signaling is mediated via its association with immunoreceptor tyrosine-based activation motif (ITAM) bearing molecules CD3zeta and FcRgamma (3). Upon receptor-engagement NK-cell cytotoxic activity and cytokine release occurs (3). This NKp46 signaling can be blocked with anti-NKp46 monoclonal antibody mediated cross-linking which causes calcium release and interferon-gamma (IFN-gamma) and tumor necrosis factor-alpha (TNF-alpha) secretion (3). NKp46 recognizes multiple ligands presented on tumor cells or pathogens and infected cells including influenza virus hemagglutinin and the parainfluenza virus hemagglutinin neuraminidase (2). Additional ligands for the NKp46 receptor include heparan sulfate (HS) glycosaminoglycans (GAGs), hemagglutinin of human vaccina virus, and vimentin expressed on cells infected with Mycobacterium tuberculosis (3).
NKp46 and its NCR counterparts have shown to be successful targets for cancer immunotherapy. More specifically, human and mouse NKp46 has shown promise in virotherapy due to its ability to stimulate NK cell activation by binding to reovirus sigma1 protein in a sialic acid-dependent manner (3). Another approach for NKp46 in cancer immunotherapy is through the use of NCR based chimeric antigen receptors (CARs). In this therapy, NCR1 supplied human T cells with anti-tumor properties via cytokine secretion, upregulation of activation markers, improved expansion, and cytotoxicity in both mouse and in vitro models (3).
References
1. Barrow, A. D., Martin, C. J., & Colonna, M. (2019). The Natural Cytotoxicity Receptors in Health and Disease. Frontiers in immunology, 10, 909. https://doi.org/10.3389/fimmu.2019.00909
2. Mandelboim, O., & Porgador, A. (2001). NKp46. The international journal of biochemistry & cell biology, 33(12), 1147-1150. https://doi.org/10.1016/S1357-2725(01)00078-4
3. Barrow, A. D., Martin, C. J., & Colonna, M. (2019). The Natural Cytotoxicity Receptors in Health and Disease. Frontiers in immunology, 10, 909. https://doi.org/10.3389/fimmu.2019.00909
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: CostimT, CyTOF-ready, Flow, Neut, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow
Species: Hu
Applications: BA
Species: Hu
Applications: Block, Simple Western, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: Bind
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow
Species: Mu
Applications: BA
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KD
Species: Hu
Applications: Block, CyTOF-reported, Flow
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: AC
Publications for NKp46/NCR1 Recombinant Protein Antigen (NBP2-58055PEP) (0)
There are no publications for NKp46/NCR1 Recombinant Protein Antigen (NBP2-58055PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NKp46/NCR1 Recombinant Protein Antigen (NBP2-58055PEP) (0)
There are no reviews for NKp46/NCR1 Recombinant Protein Antigen (NBP2-58055PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for NKp46/NCR1 Recombinant Protein Antigen (NBP2-58055PEP) (0)
Additional NKp46/NCR1 Products
Research Areas for NKp46/NCR1 Recombinant Protein Antigen (NBP2-58055PEP)
Find related products by research area.
|
Blogs on NKp46/NCR1