NIFK Antibody - BSA Free

Western Blot: NIFK Antibody [NBP2-48643] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG

Immunohistochemistry: NIFK Antibody [NBP2-48643] - Staining of human hippocampus shows moderate nucleolar positivity in neuronal cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NIFK Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NIFK Antibody - BSA Free (NBP2-48643) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYPSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NIFK
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NIFK Recombinant Protein Antigen (NBP2-48643PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NIFK Antibody - BSA Free

• hNIFK
• MKI67 (FHA domain) interacting nucleolar phosphoprotein
• MKI67 FHA domain-interacting nucleolar phosphoprotein
• NIFKNOPP34
• Nopp34
• Nucleolar phosphoprotein Nopp34
• Nucleolar protein interacting with the FHA domain of pKI-67

Background

NIFK is a nucleolar protein that interacts with Ki67, a protein strongly associated with, and a specific marker of, cell proliferation. The marsupial counterpart of human NIFK was recently identified and suggests that NIFK may be involved in the organization of higher order chromatin structure. NIFK was found to interact with the forkhead associated domain of Ki67 in mitotic cells and the interaction is thought to be phosphorylation-dependent.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NIFK