NIFK Antibody

Images

 
Genetic Strategies: Western Blot: NIFK Antibody [NBP2-48642] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/ Immunofluorescence: NIFK Antibody [NBP2-48642] - Staining of human cell line A-431 shows localization to nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NIFK Antibody [NBP2-48642] - Staining of human fallopian tube shows nucleolar positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

NIFK Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI
Specificity
Specificity of human NIFK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MKI67IP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NIFK Antibody

  • hNIFK
  • MKI67 (FHA domain) interacting nucleolar phosphoprotein
  • MKI67 FHA domain-interacting nucleolar phosphoprotein
  • NIFKNOPP34
  • Nopp34
  • Nucleolar phosphoprotein Nopp34
  • Nucleolar protein interacting with the FHA domain of pKI-67

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34009
Species: Hu
Applications: IHC, IHC-P
NBP2-29461
Species: Hu, Bv(-), Ca(-), Ha(-), Mu(-), Po(-), Rt(-), Sh(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB500-170
Species: Hu, Mu, Rt, Po
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NB600-1159
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
MAB7670
Species: Hu
Applications: WB, ICC
MAB2294
Species: Hu, Mu
Applications: WB, IHC, IP, ICC
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-87847
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88689
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NIFK Antibody (NBP2-48642) (0)

There are no publications for NIFK Antibody (NBP2-48642).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NIFK Antibody (NBP2-48642) (0)

There are no reviews for NIFK Antibody (NBP2-48642). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NIFK Antibody (NBP2-48642) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NIFK Products

Bioinformatics Tool for NIFK Antibody (NBP2-48642)

Discover related pathways, diseases and genes to NIFK Antibody (NBP2-48642). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NIFK Antibody (NBP2-48642)

Discover more about diseases related to NIFK Antibody (NBP2-48642).
 

Pathways for NIFK Antibody (NBP2-48642)

View related products by pathway.

PTMs for NIFK Antibody (NBP2-48642)

Learn more about PTMs related to NIFK Antibody (NBP2-48642).
 

Research Areas for NIFK Antibody (NBP2-48642)

Find related products by research area.

Blogs on NIFK

There are no specific blogs for NIFK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NIFK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MKI67IP