NIFK Antibody - BSA Free

Western Blot: NIFK Antibody [NBP2-48642] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.

Immunocytochemistry/Immunofluorescence: NIFK Antibody [NBP2-48642] - Staining of human cell line A-431 shows localization to nucleoli. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NIFK Antibody [NBP2-48642] - Staining of human fallopian tube shows nucleolar positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NIFK Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NIFK
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NIFK Recombinant Protein Antigen (NBP2-48642PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NIFK Antibody - BSA Free

• hNIFK
• MKI67 (FHA domain) interacting nucleolar phosphoprotein
• MKI67 FHA domain-interacting nucleolar phosphoprotein
• NIFKNOPP34
• Nopp34
• Nucleolar phosphoprotein Nopp34
• Nucleolar protein interacting with the FHA domain of pKI-67

Background

NIFK is a nucleolar protein that interacts with Ki67, a protein strongly associated with, and a specific marker of, cell proliferation. The marsupial counterpart of human NIFK was recently identified and suggests that NIFK may be involved in the organization of higher order chromatin structure. NIFK was found to interact with the forkhead associated domain of Ki67 in mitotic cells and the interaction is thought to be phosphorylation-dependent.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NIFK