NIF1 Antibody


Immunocytochemistry/ Immunofluorescence: NIF1 Antibody [NBP2-56617] - Staining of human cell line MCF7 shows localization to nucleoplasm.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

NIF1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RNGHLKFHIQRLHSPDGRKSGTPTARAPTQTPTQTIILNSDDETLATLHTALQSSHGVLGPERLQQALSQEHIIVAQEQ
Specificity of human NIF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NIF1 Recombinant Protein Antigen (NBP2-56617PEP)

Reactivity Notes

Mouse 85%, Rat 82%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for NIF1 Antibody

  • DKFZp586G1122
  • Hzf
  • HZFzinc finger protein 385
  • RZFHematopoietic zinc finger protein
  • ZFP385
  • zinc finger protein 385A
  • ZNF385Retinal zinc finger protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Mu
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu, Mu
Applications: WB, Simple Western, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ChIP, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: ICC/IF

Publications for NIF1 Antibody (NBP2-56617) (0)

There are no publications for NIF1 Antibody (NBP2-56617).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NIF1 Antibody (NBP2-56617) (0)

There are no reviews for NIF1 Antibody (NBP2-56617). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NIF1 Antibody (NBP2-56617) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional NIF1 Products

Array NBP2-56617

Bioinformatics Tool for NIF1 Antibody (NBP2-56617)

Discover related pathways, diseases and genes to NIF1 Antibody (NBP2-56617). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NIF1 Antibody (NBP2-56617)

Discover more about diseases related to NIF1 Antibody (NBP2-56617).

Pathways for NIF1 Antibody (NBP2-56617)

View related products by pathway.

PTMs for NIF1 Antibody (NBP2-56617)

Learn more about PTMs related to NIF1 Antibody (NBP2-56617).

Blogs on NIF1

There are no specific blogs for NIF1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NIF1 Antibody and receive a gift card or discount.


Gene Symbol ZNF335