NHP2L1 Antibody (5C5)

Images

 
Sandwich ELISA: NHP2L1 Antibody (5C5) [H00004809-M02] - Detection limit for recombinant GST tagged NHP2L1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
5C5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NHP2L1 Antibody (5C5) Summary

Immunogen
NHP2L1 (AAH05358, 1 a.a. - 100 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVI
Localization
Nuclear
Specificity
NHP2L1 - NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NHP2L1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NHP2L1 Antibody (5C5)

  • [U4/U6.U5] tri-snRNP 15.5 kD RNA binding protein
  • 15.5K
  • FA1
  • FA-1
  • High mobility group-like nuclear protein 2 homolog 1
  • hSNU13
  • NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae)
  • NHP2-like protein 1
  • NHPX
  • non-histone chromosome protein 2 (S. cerevisiae)-like 1
  • non-histone chromosome protein 2-like 1
  • OTK27
  • small nuclear ribonucleoprotein 15.5kDa (U4/U6.U5)
  • SNRNP15-5
  • SNU13 homolog
  • SNU13
  • SPAG12
  • sperm specific antigen 1
  • SSFA1
  • U4/U6.U5 tri-snRNP 15.5 kDa protein

Background

Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the [U4/U6.U5] tri-snRNP. It binds to the 5' stem-loop of U4 snRNA. Two transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8634
Species: Mu
Applications: WB, Simple Western, Flow, IHC
NBP1-81681
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82510
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-36778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52406
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-40354
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-57100
Species: Hu
Applications: ICC/IF
AF842
Species: Hu
Applications: WB
NBP2-20245
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-269
Species: Hu, Mu, Rt, Ce, Ch, Dr, Pl, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP2-13656
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-53795
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-76962
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC
NBP1-46063
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP

Publications for NHP2L1 Antibody (H00004809-M02) (0)

There are no publications for NHP2L1 Antibody (H00004809-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NHP2L1 Antibody (H00004809-M02) (0)

There are no reviews for NHP2L1 Antibody (H00004809-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NHP2L1 Antibody (H00004809-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NHP2L1 Products

Bioinformatics Tool for NHP2L1 Antibody (H00004809-M02)

Discover related pathways, diseases and genes to NHP2L1 Antibody (H00004809-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NHP2L1 Antibody (H00004809-M02)

Discover more about diseases related to NHP2L1 Antibody (H00004809-M02).
 

Pathways for NHP2L1 Antibody (H00004809-M02)

View related products by pathway.

PTMs for NHP2L1 Antibody (H00004809-M02)

Learn more about PTMs related to NHP2L1 Antibody (H00004809-M02).
 

Research Areas for NHP2L1 Antibody (H00004809-M02)

Find related products by research area.

Blogs on NHP2L1

There are no specific blogs for NHP2L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NHP2L1 Antibody (5C5) and receive a gift card or discount.

Bioinformatics

Gene Symbol NHP2L1
Entrez
OMIM
Uniprot