NHE8 Antibody - BSA Free

Western Blot: NHE8 Antibody [NBP3-10574] - Western blot analysis of NHE8 in Rat Small Intestine lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NHE8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NHE8 Antibody - BSA Free (NBP3-10574) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat NHE8 (NP_001020452). Peptide sequence LHKGNFFQNIGSITLFAVFGTAISAFVVGGGIYFLGQADVISKLNMTDSF
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC9A8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 63 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NHE8 Antibody - BSA Free

• DKFZp686C03237
• KIAA0939
• KIAA0939DKFZp686C03237
• MGC138418
• Na(+)/H(+) exchanger 8
• NHE8
• NHE-8
• NHE8FLJ42500
• SLC9A8
• sodium/hydrogen exchanger 8
• solute carrier family 9 (sodium/hydrogen exchanger)
• solute carrier family 9 (sodium/hydrogen exchanger), isoform 8
• solute carrier family 9 (sodium/hydrogen exchanger), member 8
• Solute carrier family 9 member 8

Background

NHE8, also known as SLC9A8, is an integral transmembrane proteins that exchange extracellular Na+ for intracellular H+. NHE8 is expressed in the kidney, where it may contribute to apical membrane ion transport physiology. NHE8 is highly expressed in the proximal tubules in the outer stripe of the outer medulla with significant but lower expression in the proximal tubules in the cortex. Sodium-Hydrogen ion Exchangers (NHEs) are a growing family of transmembrane proteins, and NHE8 antibodies are useful tools for research on NaH ion exchange.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC9A8