NHE8 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat NHE8 (NP_001020452). Peptide sequence LHKGNFFQNIGSITLFAVFGTAISAFVVGGGIYFLGQADVISKLNMTDSF |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SLC9A8 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
63 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for NHE8 Antibody - BSA Free
Background
NHE8, also known as SLC9A8, is an integral transmembrane proteins that exchange extracellular Na+ for intracellular H+. NHE8 is expressed in the kidney, where it may contribute to apical membrane ion transport physiology. NHE8 is highly expressed in the proximal tubules in the outer stripe of the outer medulla with significant but lower expression in the proximal tubules in the cortex. Sodium-Hydrogen ion Exchangers (NHEs) are a growing family of transmembrane proteins, and NHE8 antibodies are useful tools for research on NaH ion exchange.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PAGE, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF (-), IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Po, Rt
Applications: EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC-WhMt, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Rt
Applications: WB
Publications for NHE8 Antibody (NBP3-10574) (0)
There are no publications for NHE8 Antibody (NBP3-10574).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NHE8 Antibody (NBP3-10574) (0)
There are no reviews for NHE8 Antibody (NBP3-10574).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NHE8 Antibody (NBP3-10574) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NHE8 Products
Research Areas for NHE8 Antibody (NBP3-10574)
Find related products by research area.
|
Blogs on NHE8