NGFRAP1/BEX3/NADE Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NGFRAP1/BEX3/NADE Antibody [NBP1-89987] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: NGFRAP1/BEX3/NADE Antibody [NBP1-89987] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus tubules and leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NGFRAP1/BEX3/NADE Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NGFRAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NGFRAP1/BEX3/NADE Protein (NBP1-89987PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NGFRAP1/BEX3/NADE Antibody

  • BEX3
  • BEX3p75NTR-associated cell death executor
  • Brain-expressed X-linked protein 3
  • DXS6984EX-linked 3
  • HGR74
  • NADE
  • nerve growth factor receptor (TNFRSF16) associated protein 1
  • Nerve growth factor receptor-associated protein 1
  • NGFRAP1
  • Ovarian granulosa cell 13.0 kDa protein HGR74
  • ovarian granulosa cell protein (13kD)
  • protein BEX3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB367
Species: Hu, Ca
Applications: WB, IHC, ICC
NBP2-33443
Species: Hu
Applications: IHC, IHC-P
NBP2-06797
Species: Hu
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB110-74753
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-91702
Species: Hu
Applications: IHC, IHC-P
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NB110-40561
Species: Hu
Applications: WB, IP
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5789
Species: Hu, Mu, Rt
Applications: WB
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-46234
Species: Hu
Applications: WB, IHC
NBP1-47897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56311
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-89987
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for NGFRAP1/BEX3/NADE Antibody (NBP1-89987) (0)

There are no publications for NGFRAP1/BEX3/NADE Antibody (NBP1-89987).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NGFRAP1/BEX3/NADE Antibody (NBP1-89987) (0)

There are no reviews for NGFRAP1/BEX3/NADE Antibody (NBP1-89987). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NGFRAP1/BEX3/NADE Antibody (NBP1-89987) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NGFRAP1/BEX3/NADE Products

Bioinformatics Tool for NGFRAP1/BEX3/NADE Antibody (NBP1-89987)

Discover related pathways, diseases and genes to NGFRAP1/BEX3/NADE Antibody (NBP1-89987). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NGFRAP1/BEX3/NADE Antibody (NBP1-89987)

Discover more about diseases related to NGFRAP1/BEX3/NADE Antibody (NBP1-89987).
 

Pathways for NGFRAP1/BEX3/NADE Antibody (NBP1-89987)

View related products by pathway.

PTMs for NGFRAP1/BEX3/NADE Antibody (NBP1-89987)

Learn more about PTMs related to NGFRAP1/BEX3/NADE Antibody (NBP1-89987).
 

Research Areas for NGFRAP1/BEX3/NADE Antibody (NBP1-89987)

Find related products by research area.

Blogs on NGFRAP1/BEX3/NADE

There are no specific blogs for NGFRAP1/BEX3/NADE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NGFRAP1/BEX3/NADE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NGFRAP1
Entrez