NGEF Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NGEF Antibody [NBP1-88820] - Staining of human cell line A-431 shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: NGEF Antibody [NBP1-88820] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NGEF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:METRESEDLEKTRRKSASDQWNTDNEPAKVKPELLPEKEETSQADQDIQDKEPHCHIPIKRNSIFNRSIRRKSKAKARDNPERNASCLADSQDNGKSVNEPLTLNIPWSRTPPCRTAMQTDPGAQEMSESSST
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NGEF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NGEF Protein (NBP1-88820PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NGEF Antibody

  • EPHEXIN
  • ephexin-1
  • Eph-interacting exchange protein
  • neuronal guanine nucleotide exchange factorARHGEF27

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF641
Species: Mu
Applications: WB, IHC
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
AF3034
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB37861
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-33413
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32964
Species: Hu
Applications: Flow, ICC/IF, IHC-Fr
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB100-41371
Species: Hu, Mu, Rt, Ma
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-58808
Species: Hu
Applications: WB, ICC/IF
NBP1-88820
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for NGEF Antibody (NBP1-88820) (0)

There are no publications for NGEF Antibody (NBP1-88820).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NGEF Antibody (NBP1-88820) (0)

There are no reviews for NGEF Antibody (NBP1-88820). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NGEF Antibody (NBP1-88820) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NGEF Products

Bioinformatics Tool for NGEF Antibody (NBP1-88820)

Discover related pathways, diseases and genes to NGEF Antibody (NBP1-88820). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NGEF Antibody (NBP1-88820)

Discover more about diseases related to NGEF Antibody (NBP1-88820).
 

Pathways for NGEF Antibody (NBP1-88820)

View related products by pathway.

PTMs for NGEF Antibody (NBP1-88820)

Learn more about PTMs related to NGEF Antibody (NBP1-88820).

Blogs on NGEF

There are no specific blogs for NGEF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NGEF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NGEF