![Immunohistochemistry-Paraffin: NGEF Antibody [NBP1-88820] - Staining of human Duodenum shows moderate cytoplasmic and membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/NGEF-Antibody-Immunohistochemistry-Paraffin-NBP1-88820-img0008.jpg "Immunohistochemistry-Paraffin: NGEF Antibody [NBP1-88820] - Staining of human Duodenum shows moderate cytoplasmic and membranous positivity in glandular cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: METRESEDLEKTRRKSASDQWNTDNEPAKVKPELLPEKEETSQADQDIQDKEPHCHIPIKRNSIFNRSIRRKSKAKARDNPERNASCLADSQDNGKSVNEPLTLNIPWSRTPPCRTAMQTDPGAQEMSESSST |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NGEF |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for NGEF Antibody (NBP1-88820)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NGEF |
![Immunohistochemistry-Paraffin: NGEF Antibody [NBP1-88820] - Staining of human Cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.](http://images.novusbio.com/fullsize/NGEF-Antibody-Immunohistochemistry-Paraffin-NBP1-88820-img0006.jpg "Immunohistochemistry-Paraffin: NGEF Antibody [NBP1-88820] - Staining of human Cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: NGEF Antibody [NBP1-88820] - Staining of human Cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells.](http://images.novusbio.com/fullsize/NGEF-Antibody-Immunohistochemistry-Paraffin-NBP1-88820-img0007.jpg "Immunohistochemistry-Paraffin: NGEF Antibody [NBP1-88820] - Staining of human Cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells.")
![Immunohistochemistry-Paraffin: NGEF Antibody [NBP1-88820] - Staining of human Pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/NGEF-Antibody-Immunohistochemistry-Paraffin-NBP1-88820-img0009.jpg "Immunohistochemistry-Paraffin: NGEF Antibody [NBP1-88820] - Staining of human Pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.")
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![Western Blot EphA1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA1_AF638_Western_Blot_17606.jpg)
![Immunocytochemistry EphA1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA1_AF638_Immunocytochemistry__Immunofluorescence_20119.jpg)
![Simple Western Vav-1 [p Tyr160] Antibody (751411) [Unconjugated]](https://images.novusbio.com/images2/Vav1_MAB37861_Simple_Western_16683.jpg)
![Western Blot Vav-1 [p Tyr160] Antibody (751411) [Unconjugated]](https://images.novusbio.com/images2/Vav-1_MAB37861_Western_Blot_12193.jpg)
![Immunocytochemistry Vav-1 [p Tyr160] Antibody (751411) [Unconjugated]](https://images.novusbio.com/images2/Vav-1_MAB37861_Immunocytochemistry_12236.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")