Recombinant Human NFYC Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NFYC Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 335 of Human NFYC full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMPAGQDLAQPMFIQSANQPSDGQAPQVTGD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
NFYC
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NFYC Protein

  • C subunit
  • nuclear transcription factor Y, gamma

Background

This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19534
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19533
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
MAB7265
Species: Mu
Applications: WB, IHC
NBP1-97572
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB110-74569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-2593
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-56082
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88871
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
H00001810-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56468
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, IHC-P
H00004802-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for NFYC Recombinant Protein (H00004802-P01) (0)

There are no publications for NFYC Recombinant Protein (H00004802-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NFYC Recombinant Protein (H00004802-P01) (0)

There are no reviews for NFYC Recombinant Protein (H00004802-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NFYC Recombinant Protein (H00004802-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NFYC Products

Bioinformatics Tool for NFYC Recombinant Protein (H00004802-P01)

Discover related pathways, diseases and genes to NFYC Recombinant Protein (H00004802-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NFYC Recombinant Protein (H00004802-P01)

Discover more about diseases related to NFYC Recombinant Protein (H00004802-P01).
 

Pathways for NFYC Recombinant Protein (H00004802-P01)

View related products by pathway.

PTMs for NFYC Recombinant Protein (H00004802-P01)

Learn more about PTMs related to NFYC Recombinant Protein (H00004802-P01).

Blogs on NFYC

There are no specific blogs for NFYC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
NFYC Antibody (1D3)
H00004802-M01-50ug

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NFYC Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NFYC