Recombinant Human NFYA Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NFYA Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 347 of Human NFYA full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEQYTANSNSSTEQIVVQAGQIQQQQQGGVTAVQLQTEAQVASASGQQVQTLQVVQGQPLMVQVSGGQLITSTGQPIMVQAVPGGQGQTIMQVPVSGTQGLQQIQLVPPGQIQIQGGQAVQVQGQQGQTQQIIIQQPQTAVTAGQTQTQQQIAVQGQQVAQTAEGQTIVYQPVNADGTILQQVTVPVSGMITIPAASLAGAQIVQTGANTNTTSSGQGTVTVTLPVAGNVVNSGGMVMMVPGAGSVPAIQRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKDSPHMQDPNQADEEAMTQIIRVS

Protein/Peptide Type
Recombinant Protein
Gene
NFYA

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NFYA Protein

  • CAAT box DNA-binding protein subunit A
  • CBF-A
  • CBF-B
  • CCAAT-binding transcription factor subunit B
  • FLJ11236
  • HAP2 CCAAT-binding protein
  • HAP2
  • NF-YACAAT-box DNA binding protein subunit A
  • Nuclear transcription factor Y subunit A
  • nuclear transcription factor Y subunit alpha
  • nuclear transcription factor Y, alpha
  • Transcription factor NF-Y, A subunit

Background

The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds to CCAAT motifs in the promoter regions in a variety of genes. Subunit A associates with a tight dimer composed of the B and C subunits, resulting in a trimer that binds to DNA with high specificity and affinity. The sequence specific interactions of the complex are made by the A subunit, suggesting a role as the regulatory subunit. In addition, there is evidence of post-transcriptional regulation in this gene product, either by protein degradation or control of translation. Further regulation is represented by alternative splicing in the glutamine-rich activation domain, with clear tissue-specific preferences for the two isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-19534
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00004802-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB100-2593
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB110-74569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56082
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-88871
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34060
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86872
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready

Publications for NFYA Recombinant Protein (H00004800-P01) (0)

There are no publications for NFYA Recombinant Protein (H00004800-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NFYA Recombinant Protein (H00004800-P01) (0)

There are no reviews for NFYA Recombinant Protein (H00004800-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NFYA Recombinant Protein (H00004800-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NFYA Products

Bioinformatics Tool for NFYA Recombinant Protein (H00004800-P01)

Discover related pathways, diseases and genes to NFYA Recombinant Protein (H00004800-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NFYA Recombinant Protein (H00004800-P01)

Discover more about diseases related to NFYA Recombinant Protein (H00004800-P01).
 

Pathways for NFYA Recombinant Protein (H00004800-P01)

View related products by pathway.

PTMs for NFYA Recombinant Protein (H00004800-P01)

Learn more about PTMs related to NFYA Recombinant Protein (H00004800-P01).

Blogs on NFYA

There are no specific blogs for NFYA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NFYA Antibody
NBP2-19533

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NFYA Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NFYA