LYRM4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: LYRM4 Antibody [NBP1-86762] - Staining of human cell line U-251 MG shows localization to nuclear bodies. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: LYRM4 Antibody [NBP1-86762] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells.

Analysis in control (vector only transfected HEK293T lysate) and LYRM4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LYRM4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LYRM4 Antibody - BSA Free (NBP1-86762) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQVHIGQLYSTDKLIIENRD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LYRM4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LYRM4 Protein (NBP1-86762PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LYRM4 Antibody - BSA Free

• C6orf149LYR motif-containing protein 4
• CGI-203
• chromosome 6 open reading frame 149
• ISD11homolog of yeast Isd11
• LYR motif containing 4
• mitochondrial matrix Nfs1 interacting protein

Background

LYRM4 may be involved in mitochondrial iron-sulfur protein biosynthesis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for LYRM4 Antibody (NBP1-86762). (Showing 1 - 1 of 1 FAQ).

1. I was wondering if the above antibody has been shown to pick up an endogenous LYRM4 protein band by western blot in human tissue samples rather than just in overexpressed cells?
   • As far as WB application is concerned, we validated the authenticity of this antibody in LYRM4 overexpression lysates only. However, this antibody does react with endogenous protein also as evidenced by ICC/IF application in human cell line U-251 MG, wherein expected nuclear positivity of LYRM4 was observed. Besides nucleus, LYRM4 localize to mitochondria also which would appear as cytoplasmic expression as evidenced by our IHC validation in human hippocampus tissues wherein this antibody detected endogenous LYRM4. This antibody's specificity was checked with protein arrays also in which it showed single peak corresponding to interaction only with its own antigen.

Bioinformatics

• Gene Symbol: LYRM4