NFRKB Antibody (4N8H3)

Western Blot: NFRKB Antibody (4N8H3) [NBP3-33460] - Western blot analysis of lysates from 293T cells, using NFRKB Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 20s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4N8H3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

NFRKB Antibody (4N8H3) Summary

• Description: Novus Biologicals Rabbit NFRKB Antibody (4N8H3) (NBP3-33460) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 370-495 of human NFRKB (NP_001137307.1).
  
  Sequence:
  LGINEISSSFFSLLLEILLLESQASLPMLEERVLDWQSSPASSLNSWFSAAPNWAELVLPALQYLAGESRAVPSSFSPFVEFKEKTQQWKLLGQSQDNEKELAALFQLWLETKDQAFCKQENEDSS
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: NFRKB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 139 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for NFRKB Antibody (4N8H3)

• DKFZp547B2013
• DNA-binding protein R kappa-B
• INO80 complex subunit G
• INO80GDNA-binding protein R kappa B
• nuclear factor related to kappaB binding protein
• nuclear factor related to kappa-B-binding protein

Background

NFRKB (nuclear factor related to kappa-B-binding protein) was first identified as a factor that could bind a variant NF-kappa B site in the interleukin-2 receptor alpha (IL-2R alpha) gene. NFRKB appears to be a transcription factor central to immune cell development. Evidence of this comes from the identification of NFRKB as an amplified gene in several cases of acute myeloid leukemia. Additionally, in another clinical case, a partial deletion of the chromosomal region that includes NFRKB is shown to be associated with combined cellular immunodeficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NFRKB