PCBD2 Antibody - BSA Free

Western Blot: PCBD2 Antibody [NBP1-85281] - Analysis in control (vector only transfected HEK293T lysate) and PCBD2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: PCBD2 Antibody [NBP1-85281] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.

Immunohistochemistry-Paraffin: PCBD2 Antibody [NBP1-85281] - Staining of human colon shows strong cytoplasmic and membrane positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PCBD2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCBD2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PCBD2 Protein (NBP1-85281PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PCBD2 Antibody - BSA Free

• 4-alpha-hydroxy-tetrahydropterin dehydratase 2
• DCOH2DCOHMPHS2,6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1) 2
• DcoH-like protein DCoHm
• dimerization cofactor of hepatocyte nuclear factor 1 (HNF1) from muscle
• dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1)
• Dimerization cofactor of hepatocyte nuclear factor 1 from muscle
• EC 4.2.1.96
• HNF-1-alpha dimerization cofactor
• PHS 2
• pterin-4 alpha-carbinolamine dehydratase 2
• pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocytenuclear factor 1 alpha (TCF1) 2
• pterin-4-alpha-carbinolamine dehydratase 2

Background

PCBD2, also known as Pterin-4-alpha-carbinolamine dehydratase 2, is a 130 amino acid protein that is 14 kDa, involved in tetrahydrobiopterin biosynthesis preventing the formation of 7-pterins and accelerating the formation of quinonoid-BH2, also being known to regulate the dimerization of homeodomain protein HNF-1-alpha and enhances its transcriptional activity. The protein is being studied for its involvement in hyperphenylalaninemia. The PCBD2 has also been shown to have interactions with DYRK1B, AATF, ASCC2, C1D, and CHAF1A in pathways such as phenylalanine degradation I (aerobic) pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PCBD2 Antibody (NBP1-85281)(1)

Publication using NBP1-85281

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: PCBD2