NFKBIL2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit NFKBIL2 Antibody - BSA Free (NBP2-48847) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: IRVRVQVQDHLFLIPVPHSSDTHSVAWLAEQAAQRYYQTCGLLPRLTLRKEGALLAPQDLIPDVLQSNDEVLAEVTSWDLPPLTDRYRRACQSLGQGEHQQVLQAVELQGLGLSFSACSLALDQAQLTPLLRALKLHT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TONSL |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for NFKBIL2 Antibody - BSA Free
Background
Sharing some sequence similarities with IKBKB, NF-kappa-B inhibitor-like protein 2 (NFKBIL2) belongs to the Tonsoku family. Also known as TONSL, the protein encoded by this gene may bind NF-kappa-B complex and trap them in the cytoplasm, preventing them from entering the nucleus and interacting with the DNA. Additionally, NFKBIL2 is a component of the MMS22L-TONSL complex. Used during DNA replication, this complex is essential for promoting homologous recombination repair of replication fork double strand breaks. NFKBIL2 is known to interact with MMS22L, MCM4, SSRP1, GSK3B and MCM2. Diseases associated with this gene include t-cell leukemia, psoriasis, breast cancer, atherosclerosis, leukemia and immunodeficiency.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: AgAct, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Mu
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for NFKBIL2 Antibody (NBP2-48847) (0)
There are no publications for NFKBIL2 Antibody (NBP2-48847).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NFKBIL2 Antibody (NBP2-48847) (0)
There are no reviews for NFKBIL2 Antibody (NBP2-48847).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NFKBIL2 Antibody (NBP2-48847) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NFKBIL2 Products
Blogs on NFKBIL2