IKB zeta Antibody - BSA Free

Staining of human cerebral cortex shows low positivity in neurons as expected.

Staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.

Staining of human skeletal muscle shows low positivity in myocytes as expected.

Staining of human rectum shows strong nuclear positivity in lymphoid cells.

• Reactivity: Hu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IKB zeta Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IKB zeta Antibody - BSA Free (NBP1-89835) is a polyclonal antibody validated for use in IHC. Anti-IKB zeta Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELLL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NFKBIZ
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: IHC-P-Retrieval method: HIER pH6
• Control Peptide:

  IKB zeta Protein (NBP1-89835PEP)

Reactivity Notes

Rat (89%). Use in Mouse reported in scientific publication (PMID: 32647171).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IKB zeta Antibody - BSA Free

• FLJ30225
• FLJ34463
• ikappaBzeta
• I-kappa-B-zeta
• IkappaB-zeta
• ikbzeta
• IkB-zeta
• IL-1 inducible nuclear ankyrin-repeat protein
• INAPIkappa B-zeta variant 3
• MAILIKBZikB-zeta
• Molecule possessing ankyrin repeats induced by lipopolysaccharide
• NF-kappa-B inhibitor zeta
• nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor

Background

IkappaBzeta (also known as MAIL and INAP) is an ankyrin-repeat-containing nuclear protein that is highly homologous to the IkappaB family member Bcl-3. Transcription of IkappaBzeta is upregulated by stimulation with TLR ligands, IL-1 and IL-6 in cultured B-lymphocytes and monocytes/macrophages, but only faintly so in T-lymphocytes, fibroblasts, and endothelial cells. IkappaB-zeta preferentially associates with the NF-kappaB subunit p50 rather than p65 and recombinant IkappaB-zeta proteins inhibit the DNA binding of the p65/p50 heterodimer and the p50/p50 homodimer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IKB zeta Antibody (NBP1-89835)(3)

Publications using NBP1-89835

• Kolb A, Kulis-Mandic A, Klein M et al. Constitutive expression of the transcriptional co-activator I kappa B zeta promotes melanoma growth and immunotherapy resistance. Nature Communications 2025-06-25 [PMID: 40562773]
• Arra M, Swarnkar G, Alippe Y et al. I kappa B-zeta signaling promotes chondrocyte inflammatory phenotype, senescence, and erosive joint pathology Bone research 2022-02-11 [PMID: 35145063] (IF/IHC, Mouse)
• Arra M, Swarnkar G, Ke K et al. LDHA-mediated ROS generation in chondrocytes is a potential therapeutic target for osteoarthritis Nat Commun 2020-07-09 [PMID: 32647171] (IHC-P, Mouse)

Bioinformatics

• Gene Symbol: NFKBIZ
• Entrez:
  • 64332(Human)
• Uniprot:
  • Q9BYH8(Human)