IKB zeta Antibody

Images

 
Immunohistochemistry-Paraffin: IKB zeta Antibody [NBP1-89835] - Staining of human bone marrow shows strong nuclear positivity in hematopoietic cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IKB zeta Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NFKBIZ
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10 - 1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IKB zeta Protein (NBP1-89835PEP)

Reactivity Notes

Rat (89%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IKB zeta Antibody

  • FLJ30225
  • FLJ34463
  • ikappaBzeta
  • I-kappa-B-zeta
  • IkappaB-zeta
  • ikbzeta
  • IkB-zeta
  • IL-1 inducible nuclear ankyrin-repeat protein
  • INAPIkappa B-zeta variant 3
  • MAILIKBZikB-zeta
  • Molecule possessing ankyrin repeats induced by lipopolysaccharide
  • NF-kappa-B inhibitor zeta
  • nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
AF1857
Species: Mu
Applications: WB, Simple Western, IP
NBP2-29946
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-46179
Species: Hu
Applications: WB, IHC, IHC-P, IP

Publications for IKB zeta Antibody (NBP1-89835) (0)

There are no publications for IKB zeta Antibody (NBP1-89835).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IKB zeta Antibody (NBP1-89835) (0)

There are no reviews for IKB zeta Antibody (NBP1-89835). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IKB zeta Antibody (NBP1-89835) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IKB zeta Products

Bioinformatics Tool for IKB zeta Antibody (NBP1-89835)

Discover related pathways, diseases and genes to IKB zeta Antibody (NBP1-89835). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IKB zeta Antibody (NBP1-89835)

Discover more about diseases related to IKB zeta Antibody (NBP1-89835).
 

Pathways for IKB zeta Antibody (NBP1-89835)

View related products by pathway.

PTMs for IKB zeta Antibody (NBP1-89835)

Learn more about PTMs related to IKB zeta Antibody (NBP1-89835).

Blogs on IKB zeta

There are no specific blogs for IKB zeta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IKB zeta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NFKBIZ
Entrez
Uniprot