IKB zeta Antibody

Immunohistochemistry-Paraffin: IKB zeta Antibody [NBP1-89835] - Analysis in human bone marrow and cerebral cortex tissues using NBP1-89835 antibody. Corresponding IKB zeta RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: IKB zeta Antibody [NBP1-89835] - Staining of human skeletal muscle shows low positivity in myocytes as expected.

Immunohistochemistry-Paraffin: IKB zeta Antibody [NBP1-89835] - Staining of human bone marrow shows high expression.

Immunohistochemistry-Paraffin: IKB zeta Antibody [NBP1-89835] - Staining of human cerebral cortex shows low expression as expected.

Immunohistochemistry-Paraffin: IKB zeta Antibody [NBP1-89835] - Staining of human recctum shows strong nuclear positivity in lymphoid cells.

• Reactivity: Hu, Mu
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

IKB zeta Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELLL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NFKBIZ
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: IHC-P-Retrieval method: HIER pH6
• Control Peptide:

  IKB zeta Protein (NBP1-89835PEP)

Reactivity Notes

Rat (89%). Use in Mouse reported in scientific publication (PMID: 32647171).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IKB zeta Antibody

• FLJ30225
• FLJ34463
• ikappaBzeta
• I-kappa-B-zeta
• IkappaB-zeta
• ikbzeta
• IkB-zeta
• IL-1 inducible nuclear ankyrin-repeat protein
• INAPIkappa B-zeta variant 3
• MAILIKBZikB-zeta
• Molecule possessing ankyrin repeats induced by lipopolysaccharide
• NF-kappa-B inhibitor zeta
• nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor

Background

IkappaBzeta (also known as MAIL and INAP) is an ankyrin-repeat-containing nuclear protein that is highly homologous to the IkappaB family member Bcl-3. Transcription of IkappaBzeta is upregulated by stimulation with TLR ligands, IL-1 and IL-6 in cultured B-lymphocytes and monocytes/macrophages, but only faintly so in T-lymphocytes, fibroblasts, and endothelial cells. IkappaB-zeta preferentially associates with the NF-kappaB subunit p50 rather than p65 and recombinant IkappaB-zeta proteins inhibit the DNA binding of the p65/p50 heterodimer and the p50/p50 homodimer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IKB zeta Antibody (NBP1-89835)(2)

Publications using NBP1-89835

• Arra M, Swarnkar G, Alippe Y et al. I kappa B-zeta signaling promotes chondrocyte inflammatory phenotype, senescence, and erosive joint pathology Bone research 2022-02-11 [PMID: 35145063] (IHC, Mouse)
• Arra M, Swarnkar G, Ke K et al. LDHA-mediated ROS generation in chondrocytes is a potential therapeutic target for osteoarthritis Nat Commun 2020-07-09 [PMID: 32647171] (IHC-P, Mouse)

Bioinformatics

• Gene Symbol: NFKBIZ
• Entrez:
  • 64332(Human)
• Uniprot:
  • Q9BYH8(Human)