NFKBIL1 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of NFKBIL1. Peptide sequence: RGPPLEEQGALKRYLRVQQVRWHPDRFLQRFRSQIETWELGRVMGAVTAL The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NFKBIL1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for NFKBIL1 Antibody - BSA Free
Background
NFKBIL1 encodes a divergent member of the I-kappa-B family of proteins. Its function has not been determined. The gene lies within the major histocompatibility complex (MHC) class I region on chromosome 6. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (1). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Pm, Ca, Pm, Hu, Pm, Sq
Applications: Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Ca, Eq, Fe, Hu, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, PEP-ELISA, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: WB
Publications for NFKBIL1 Antibody (NBP2-84179) (0)
There are no publications for NFKBIL1 Antibody (NBP2-84179).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NFKBIL1 Antibody (NBP2-84179) (0)
There are no reviews for NFKBIL1 Antibody (NBP2-84179).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NFKBIL1 Antibody (NBP2-84179) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NFKBIL1 Products
Research Areas for NFKBIL1 Antibody (NBP2-84179)
Find related products by research area.
|
Blogs on NFKBIL1