NFKBIL1 Antibody - BSA Free

Western Blot: NFKBIL1 Antibody [NBP2-84179] - WB Suggested Anti-Nfkbil1 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Liver

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NFKBIL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NFKBIL1 Antibody - BSA Free (NBP2-84179) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of NFKBIL1. Peptide sequence: RGPPLEEQGALKRYLRVQQVRWHPDRFLQRFRSQIETWELGRVMGAVTAL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NFKBIL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NFKBIL1 Antibody - BSA Free

• IkappaBL
• I-kappa-B-like protein
• IKBLikappaBL
• Inhibitor of kappa B-like protein
• LST1
• NF-kappa-B inhibitor-like protein 1
• nuclear factor of kappa light polypeptide gene enhancer in B-cellsinhibitor-like 1NFKBIL

Background

NFKBIL1 encodes a divergent member of the I-kappa-B family of proteins. Its function has not been determined. The gene lies within the major histocompatibility complex (MHC) class I region on chromosome 6. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (1). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NFKBIL1