NFAT5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NFAT5 Antibody [NBP2-49612] - Immunofluorescent staining of human cell line SiHa shows localization to nucleus.

staining of human cervix shows moderate nuclear positivity in squamous epithelial cells.

Staining of human cerebral cortex shows moderate nuclear positivity in neurons.

Staining of human kidney shows moderate nuclear positivity in cells in proximal tubules.

Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

ChIP-Exo-Seq composite graph for Anti-NFAT5 (NBP2-49612) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NFAT5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NFAT5 Antibody - BSA Free (NBP2-49612) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SMWMEDSPSNFSNMSTSSYNDNTEVPRKSRKRNPKQRPGVKRRDCEESNMDIFDADSAKAPHYVLSQLTTDNKGNSKAGNGT
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NFAT5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NFAT5 Recombinant Protein Antigen (NBP2-49612PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NFAT5 Antibody - BSA Free

• EC 3.6.1
• EC 3.6.3.14
• KIAA0827glutamine rich protein H65
• NF-AT5NFAT-like protein 1
• NFATL1
• NFATZ
• nuclear factor of activated T-cells 5, tonicity-responsive
• OREBP
• osmotic response element-binding protein
• T-cell transcription factor NFAT5
• TonE-binding protein
• TonEBP
• TONEBPnuclear factor of activated T-cells 5
• Tonicity-responsive enhancer-binding protein

Background

The nuclear factor of activated T-cells (NFAT) transcription complex is required for the expression of a group of proteins that collectively regulate the immune response. Four NFAT proteins, encoded on separate genes and expressed as several splice variants, have been described: NFAT1 (also known as NFATp or NFATc2), NFAT2 (NFATc or NFATc1), NFAT3, and NFAT4 (NFATx or NFATc3). These proteins show a low level of sequence similarity with the Dorsal/Rel/NFkB family of transcription factors. Another NFAT-related protein termed NFAT5 differs from isoforms 1-4 in that it lacks many of the Fos/Jun contact sites observed in its predecessors and its subcellular localization is not calcineurin-dependent.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NFAT5