Neuropilin-2 Antibody

Images

 
Immunohistochemistry-Paraffin: Neuropilin-2 Antibody [NBP1-86866] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Neuropilin-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NRP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Neuropilin-2 Protein (NBP1-86866PEP)
Publications
Read Publication using
NBP1-86866 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Neuropilin-2 Antibody

  • MGC126574
  • neuropilin 2
  • Neuropilin2
  • Neuropilin-2
  • neuropilin-2a(22)
  • neuropilin-2b(0)
  • NP2
  • NPN 2
  • NPN2
  • PRO2714
  • receptor for VEGF165 and semaphorins class3
  • Vascular endothelial cell growth factor 165 receptor 2
  • vascular endothelial growth factor-165 receptor 2
  • VEGF1265R2
  • VEGF165R2neuropilin-2a(17)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
AF7109
Species: Mu
Applications: WB, IHC
NBP1-81162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-84682
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2218
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF743
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-31551
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF4075
Species: Mu, Rt
Applications: WB, IHC
NBP1-86866
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Neuropilin-2 Antibody (NBP1-86866)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Neuropilin-2 Antibody (NBP1-86866) (0)

There are no reviews for Neuropilin-2 Antibody (NBP1-86866). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neuropilin-2 Antibody (NBP1-86866). (Showing 1 - 1 of 1 FAQ).

  1. Why are the bands shown in the WB different molecular weight? What is the correct size for nrp2? Are they isoforms? I think the dominant one will be 110 KD.
    • It is not the wrong WB image for the NBP1-86866 antibody. This antibody is designed from sequence information in the ENSEMBL database and according to the ENSEMBL database, there is an additional isoform of 62.5 kDa. The antigen of the NBP1-86866 antibody has 100% sequence identity to this isoform as well. The isoform is called NRP2-202 (ENSP00000347238) and consists of 555 amino acids (ENST00000355117).

Secondary Antibodies

 

Isotype Controls

Additional Neuropilin-2 Products

Bioinformatics Tool for Neuropilin-2 Antibody (NBP1-86866)

Discover related pathways, diseases and genes to Neuropilin-2 Antibody (NBP1-86866). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neuropilin-2 Antibody (NBP1-86866)

Discover more about diseases related to Neuropilin-2 Antibody (NBP1-86866).
 

Pathways for Neuropilin-2 Antibody (NBP1-86866)

View related products by pathway.

PTMs for Neuropilin-2 Antibody (NBP1-86866)

Learn more about PTMs related to Neuropilin-2 Antibody (NBP1-86866).
 

Research Areas for Neuropilin-2 Antibody (NBP1-86866)

Find related products by research area.

Blogs on Neuropilin-2

There are no specific blogs for Neuropilin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neuropilin-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NRP2
Entrez
Uniprot