Recombinant Human Neuropeptide Y GST (N-Term) Protein Summary
| Description |
Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-97 of Human NPY Source: Wheat Germ (in vitro) Amino Acid Sequence: MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW |
Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source |
Wheat germ |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
NPY |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
| Theoretical MW |
36.41 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Neuropeptide Y GST (N-Term) Protein
Background
NPY a 36 amino acid peptide amide isolated from porcine brain, is a major regulatory neuropeptide in the mammalian central and peripheral nervous systems. NPY belongs to the pancreatic polypeptide family of peptides which are characterized by a common tertiary structure. Within this family, an intestinal peptide hormone, peptide YY (PYY), is most closely related to NPY. In the central nervous system (CNS) NPY is considered to be involved in regulation of blood pressure, memory processing, circadian rhythm, and stimulation of food intake. In the peripheral nervous system (PNS), NPY evokes potent vasoconstrictor activity and acts as a transmitter/neuromodulator of sympathetic neurons and adrenal glands. NPY is one of the most abundant peptides found in the CNS. NPY and NPY mRNA are widely distributed in the brain. High levels of NPY are present in the cerebral cortex, amygdaloid nuclei, hippocampal formation, and hypothalamus. In the PNS, NPY is widely distributed in sympathetic neurons that innervate vascular smooth muscle, heart, and urogenital tract. In these neurons NPY is mainly co-localized with norepinephrine and is considered to function as a neurotransmitter to presynaptically inhibit nor adrenergic neurotransmission. The biological actions of NPY in the brain and periphery are mediated by at least two different NPY receptors, designated Y1 and Y2 receptor subtypes. Cardiovascular effects and centrally evoked food intake potential are activities predominantly mediated by the Y1 receptors, whereas the Y2 receptors, the major subtype in the CNS, are mainly involved in the pre-synaptic inhibition of neurotransmitter release and facilitation of memory retention. Post-synaptic NPY receptors are apparently of both the Y1 and Y2 type. NPY receptors are coupled to at least two different signal transduction mechanisms, the adenylate cyclase pathway (decrease in cAMP), and the phosphoinositol/IP3 pathway. Antibodies that react specifically with NPY are useful for the study of the mode of action, differential tissue expression, and intracellular and subcellular localization of NPY in the central and peripheral nervous systems.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB, ELISA, MA, AP
Publications for Neuropeptide Y Recombinant Protein (H00004852-P01) (0)
There are no publications for Neuropeptide Y Recombinant Protein (H00004852-P01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Neuropeptide Y Recombinant Protein (H00004852-P01) (0)
There are no reviews for Neuropeptide Y Recombinant Protein (H00004852-P01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Neuropeptide Y Recombinant Protein (H00004852-P01) (0)
Additional Neuropeptide Y Products
Research Areas for Neuropeptide Y Recombinant Protein (H00004852-P01)
Find related products by research area.
|
Blogs on Neuropeptide Y