Neuronal Pentraxin 1 Antibody - BSA Free

Western Blot: Neuronal Pentraxin 1 Antibody [NBP3-09979] - Western blot analysis of Neuronal Pentraxin 1 in Human 786-0 Whole Cell. Antibody dilution at 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Neuronal Pentraxin 1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human Neuronal Pentraxin 1 (NP_002513.2). Peptide sequence DTEERVKIETALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMYAKV
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NPTX1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 47 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Neuronal Pentraxin 1 Antibody - BSA Free

• DKFZp686J2446
• MGC105123
• Neuronal Pentraxin 1
• neuronal pentraxin INP1NP-I
• neuronal pentraxin-1
• NP1
• NPTX1

Background

NPTX1 is a member of the neuronal pentraxin gene family. Neuronal pentraxin 1 is similar to the rat NP1 gene which encodes a binding protein for the snake venom toxin taipoxin. Human NPTX1 mRNA is exclusively localized to the nervous system. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NPTX1