Neurolysin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Neurolysin Antibody [NBP1-89198] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: Neurolysin Antibody [NBP1-89198] - Staining of human stomach shows moderate granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Neurolysin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LRMTLGREVMSPLQAMSSYTVAGRNVLRWDLSPEQIKTRTEELIVQTKQVYDAVGMLGIEEVTYENCL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NLN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Neurolysin Protein (NBP1-89198PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Neurolysin Antibody

  • AGTBP
  • AGTBPFLJ23002
  • angiotensin binding protein
  • Angiotensin-binding protein
  • DKFZp564F123
  • EC 3.4.24
  • EC 3.4.24.16
  • KIAA1226EP24.16
  • MEP
  • mitochondrial
  • MOP
  • neurolysin (metallopeptidase M3 family)
  • Neurolysin
  • Neurotensin Endopeptidase
  • NLN
  • Oligopeptidase M

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-45861
Species: Hu
Applications: WB, Flow, IHC, IF
NBP2-58661
Species: Hu
Applications: IHC-P
NB600-1397
Species: Hu, Bv, Ca, Mk, Rb
Applications: WB, Flow, IHC, IHC-P, IP, MiAr, CyTOF-ready, Flow-IC
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
AF3749
Species: Hu
Applications: WB, IHC
MAB4077
Species: Hu
Applications: WB, IHC
NB100-266
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF6108
Species: Hu
Applications: IHC
NBP1-87974
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-146
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69668
Species: Hu
Applications: WB
NBP2-07087
Species: Hu
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87987
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for Neurolysin Antibody (NBP1-89198) (0)

There are no publications for Neurolysin Antibody (NBP1-89198).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neurolysin Antibody (NBP1-89198) (0)

There are no reviews for Neurolysin Antibody (NBP1-89198). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Neurolysin Antibody (NBP1-89198) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neurolysin Products

Bioinformatics Tool for Neurolysin Antibody (NBP1-89198)

Discover related pathways, diseases and genes to Neurolysin Antibody (NBP1-89198). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neurolysin Antibody (NBP1-89198)

Discover more about diseases related to Neurolysin Antibody (NBP1-89198).
 

Pathways for Neurolysin Antibody (NBP1-89198)

View related products by pathway.

Research Areas for Neurolysin Antibody (NBP1-89198)

Find related products by research area.

Blogs on Neurolysin

There are no specific blogs for Neurolysin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neurolysin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NLN
Entrez