Neuroglycan C/CSPG5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Neuroglycan C/CSPG5 Antibody [NBP2-58590] - Staining of human cell line HEK 293 shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Neuroglycan C/CSPG5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SLSTIAEGSHPNVRKLCNTPRTSSPHARALAHYDNVICQDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNCL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CSPG5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Neuroglycan C/CSPG5 Recombinant Protein Antigen (NBP2-58590PEP)

Reactivity Notes

Mouse 89%, Rat 89%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Neuroglycan C/CSPG5 Antibody - BSA Free

• CALEB
• chondroitin sulfate proteoglycan 5 (neuroglycan C)
• chondroitin sulfate proteoglycan 5
• CSPG5
• MGC44034
• Neuroglycan C
• NGC
• NGCAcidic leucine-rich EGF-like domain-containing brain protein

Background

Many cellular activities depend on the interaction of cells with the surrounding extracellular matrix (ECM). Most cells, in intact tissue and in culture, are attached to an ECM. Epithelial cells are associated with the basement membrane; fibroblastic cells are usually embedded in a pericellular mesh of fibrils, and tissue culture cells usually grow on a substrate which is covered by various ECM components. Studies have indicated that the matrix or its various isolated components provide not only adhesive surfaces for cells to grow on but also have effects on the rate of cell growth, mobility, morphogenesis and differentiation. Within the ECM several glycoproteins and proteoglycans have been identified. It has been proposed that the different constituents interact with each other in a rather complex fashion. The poor antigenicity of proteoglycans especially their glycoaminoglycan (GAG) moieties make it difficult to localize these molecules in tissue and cell culture. Monoclonal Anti-Chondroitin Sulfate can be used to study chondroitin sulfate proteoglycan (CSPG) distribution and its relationships to specific cell-substrate contacts.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CSPG5