Neuroglycan C/CSPG5 Antibody (5C11) - Azide and BSA Free Summary
| Immunogen |
CSPG5 (NP_006565, 445 a.a. ~ 539 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KKLYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIAEGSHPNDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNCLQNNLT |
| Localization |
Endoplasmic reticulum, Golgi Apparatus and Plasma membrane |
| Specificity |
CSPG5 - chondroitin sulfate proteoglycan 5 (neuroglycan C) |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
CSPG5 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Neuroglycan C/CSPG5 Antibody (5C11) - Azide and BSA Free
Background
Neuroglycan C is a transmembrane chondroitin sulfate proteoglycan that is exclusively expressed in the central nervous system. NGC gene expression is developmentally regulated being altered by addiction to psychostimulants and by nerve lesion. Its core protein has a particular multidomain structure differing from those of other known proteoglycans, and this protein is modified post-translationally in various ways such as phosphorylation and glycosylation. Neuroglycan C is a novel part-time proteoglycan that changes its structure from a proteoglycan form to a non-proteoglycan form without chondroitin sulfate chains during the development of the cerebellum and retina. Evidence suggests that Neuroglycan C is involved in neuronal circuit formation in the central nervous system.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC, Simple Western, WB
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Publications for Neuroglycan C/CSPG5 Antibody (H00010675-M01) (0)
There are no publications for Neuroglycan C/CSPG5 Antibody (H00010675-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Neuroglycan C/CSPG5 Antibody (H00010675-M01) (0)
There are no reviews for Neuroglycan C/CSPG5 Antibody (H00010675-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Neuroglycan C/CSPG5 Antibody (H00010675-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Neuroglycan C/CSPG5 Products
Research Areas for Neuroglycan C/CSPG5 Antibody (H00010675-M01)
Find related products by research area.
|
Blogs on Neuroglycan C/CSPG5