Nesprin 2 Antibody

Images

 
Immunohistochemistry-Paraffin: Nesprin 2 Antibody [NBP1-84190] - Staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Nesprin 2 Antibody [NBP1-84190] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: Nesprin 2 Antibody [NBP1-84190] - Staining of human cerebral cortex, kidney, skin and testis using Anti-SYNE2 antibody NBP1-84190 (A) shows similar protein distribution across tissues to ...read more
Immunohistochemistry-Paraffin: Nesprin 2 Antibody [NBP1-84190] - Staining of human kidney shows moderate to strong positivity in nuclear membrane in cells in tubules.
Immunohistochemistry-Paraffin: Nesprin 2 Antibody [NBP1-84190] - Staining of human skin shows moderate positivity in nuclear membrane in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nesprin 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NVLNDAYENLTRYKEAVTRAVESITSLEAIIIPYRVDVGNPEESLEMPLRKQEELESTVARIQDLTEKLGMISSPEAKLQLQYTLQELVSKNSAMKEAFKAQETEAE
Specificity
Specificity of human Nesprin 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYNE2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
IHC reported in scientific literature (PMID: 25482017). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Western blot reported in scientific literature (PMID: 31006653).
Control Peptide
Nesprin 2 Protein (NBP1-84190PEP)
Publications
Read Publications using
NBP1-84190 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25482017). Rat reactivity reported in scientific literature (PMID: 31006653).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nesprin 2 Antibody

  • DKFZP434H2235
  • DKFZp686E01115
  • DKFZp686H1931
  • EDMD5
  • FLJ46790
  • KIAA1011FLJ11014
  • nesprin 2
  • Nesprin-2
  • NUAFLJ43727
  • NUANCEFLJ45710
  • Nuclear envelope spectrin repeat protein 2
  • Nucleus and actin connecting element protein
  • polytrophin
  • Protein NUANCE
  • spectrin repeat containing, nuclear envelope 2
  • Synaptic nuclear envelope protein 2
  • synaptic nuclei expressed gene 2
  • SYNE-2
  • TROPH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75679
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-75696
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56649
Species: Hu
Applications: WB, ICC/IF, Flow-IC
NBP1-87396
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-06590
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84019
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49175
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IHC-WhMt, KD
NB100-59787
Species: Hu, Mu
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, IP, PLA, KD
NBP1-31209
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84190
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for Nesprin 2 Antibody (NBP1-84190)(2)

We have publications tested in 2 confirmed species: Human, Rat.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Rat
(1)
All Species

Reviews for Nesprin 2 Antibody (NBP1-84190) (0)

There are no reviews for Nesprin 2 Antibody (NBP1-84190). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nesprin 2 Antibody (NBP1-84190) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Nesprin 2 Products

Bioinformatics Tool for Nesprin 2 Antibody (NBP1-84190)

Discover related pathways, diseases and genes to Nesprin 2 Antibody (NBP1-84190). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nesprin 2 Antibody (NBP1-84190)

Discover more about diseases related to Nesprin 2 Antibody (NBP1-84190).
 

Pathways for Nesprin 2 Antibody (NBP1-84190)

View related products by pathway.

PTMs for Nesprin 2 Antibody (NBP1-84190)

Learn more about PTMs related to Nesprin 2 Antibody (NBP1-84190).

Blogs on Nesprin 2

There are no specific blogs for Nesprin 2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nesprin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYNE2
Entrez
Uniprot