Neogenin Antibody - BSA Free

Western Blot: Neogenin Antibody [NBP1-89651] - Analysis in human cell lines A-549 and HeLa using anti-NEO1 antibody. Corresponding NEO1 RNA-seq data are presented for the same cell lines. Loading control: anti-PARP1.

Immunocytochemistry/Immunofluorescence: Neogenin Antibody [NBP1-89651] - Staining of human cell line U-2 OS shows localization to nucleoplasm & plasma membrane. Antibody staining shown in green.

Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli.

Immunohistochemistry-Paraffin: Neogenin Antibody [NBP1-89651] - Staining of human placenta shows no positivity in trophoblastic cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Neogenin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SVNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPNPIMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAGR
• Predicted Species: Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NEO1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Frozen Reported in scientific literature (PMID: 30333477)
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Neogenin Protein (NBP1-89651PEP)

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 30333477)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Neogenin Antibody - BSA Free

• HsT17534
• IGDCC2DKFZp547B146
• Immunoglobulin superfamily DCC subclass member 2
• NEO
• NEO1
• neogenin (chicken) homolog 1
• neogenin 1
• neogenin homolog 1
• Neogenin
• NGN
• NGNDKFZp547A066

Background

Neogenin is one of several netrin-binding proteins. Neogenin functions as an Repulsive Guidance Molecule (RGM) receptor; RGM is implicated in axonal guidance and neural tube closure.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Neogenin Antibody (NBP1-89651)(8)

Publications using NBP1-89651

• Park JW, Kim YJ, Lee SJ et al. Down-Regulation of Neogenin Decreases Proliferation and Differentiation of Spermatogonia during the Early Phase of Spermatogenesis International journal of molecular sciences 2022-11-25 [PMID: 36499089] (IHC-P, Rat)
  
  Details:
  1:100 IHC-P dilution
• Untiveros G, Raskind A, Linares L et al. Netrin-1 Stimulates Migration of Neogenin Expressing Aggressive Melanoma Cells International Journal of Molecular Sciences 2022-10-22 [PMID: 36361539] (ICC/IF, Human)
• Yuan X, Xiao H, Hu Q et al. RGMa promotes dedifferentiation of vascular smooth muscle cells into a macrophage-like phenotype in�vivo and in�vitro Journal of Lipid Research 2022-10-01 [PMID: 36089003] (Immunohistochemistry)
• Jiang RC, Zheng XY, Yang SL Et al. CD146 mediates the anti-apoptotic role of Netrin-1 in endothelial progenitor cells under hypoxic conditions Molecular medicine reports 2022-01-01 [PMID: 34738629] (WB, Mouse)
• A Abdullah, C Herdenberg, H Hedman Netrin-1 functions as a suppressor of bone morphogenetic protein (BMP) signaling Scientific Reports, 2021-04-21;11(1):8585. 2021-04-21 [PMID: 33883596]
• Kim Y, Park Y, Park Y et al. Role of RGMc as a Neogenin Ligand in Follicular Development in the Ovary Biomedicines 2021-03-10 [PMID: 33801938] (WB, Mouse)
• Tanabe S, Fujita Y, Ikuma k, Yamashita T. Inhibiting repulsive guidance molecule-a suppresses secondary progression in mouse models of multiple sclerosis. Cell Death Dis. 2018-10-17 [PMID: 30333477] (IHC-Fr, Mouse)
• Tanabe S, Yamashita T. Repulsive Guidance Molecule-a Is Involved in Th17-Cell-Induced neurodegeneration in Autoimmune Encephalomyelitis. Cell Rep. 2014-11-20 [PMID: 25456136] (IF/IHC)

Bioinformatics

• Gene Symbol: NEO1