NEK9 Antibody

Images

 
Western Blot: NEK9 Antibody [NBP1-88007] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-431
Immunocytochemistry/ Immunofluorescence: NEK9 Antibody [NBP1-88007] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: NEK9 Antibody [NBP1-88007] - Staining of human testis shows cytoplasmic positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NEK9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VSCGDEFTIAATDDNHIFAWGNGGNGRLAMTPTERPHGSDICTSWPRPIFGSLHHVPDLSCRGWHTILIVEKVLNSKTIRSNSSGLSIGTVFQSSSPGGGGGGGGGEEEDSQQESETPDPSGGFRGTMEADRGMEGLISPTEAM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEK9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NEK9 Protein (NBP1-88007PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NEK9 Antibody

  • DKFZp434D0935
  • KIAA1995
  • MGC138306
  • MGC16714
  • NEK8
  • Nek8NERCC1
  • Nercc1 kinase
  • NERCCEC 2.7.11.1
  • Never in mitosis A-related kinase 9
  • NIMA (never in mitosis gene a)- related kinase 9
  • NimA-related kinase 8
  • NIMA-related kinase Nek8
  • NimA-related protein kinase 9
  • serine/threonine-protein kinase Nek9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47865
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-31110
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00004751-M11
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-181
Species: Hu, Mu, Rt, Po, Dr
Applications: WB, ICC/IF, IP
NBP1-85637
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82883
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00027130-P02
Species: Hu
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
AF877
Species: Hu
Applications: WB, IHC, IP
NBP2-13650
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83543
Species: Hu
Applications: IHC, IHC-P
AF6270
Species: Hu
Applications: ICC
NBP2-39059
Species: Hu
Applications: IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00121441-M05
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88007
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NEK9 Antibody (NBP1-88007) (0)

There are no publications for NEK9 Antibody (NBP1-88007).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEK9 Antibody (NBP1-88007) (0)

There are no reviews for NEK9 Antibody (NBP1-88007). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NEK9 Antibody (NBP1-88007) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NEK9 Products

Bioinformatics Tool for NEK9 Antibody (NBP1-88007)

Discover related pathways, diseases and genes to NEK9 Antibody (NBP1-88007). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEK9 Antibody (NBP1-88007)

Discover more about diseases related to NEK9 Antibody (NBP1-88007).
 

Pathways for NEK9 Antibody (NBP1-88007)

View related products by pathway.

PTMs for NEK9 Antibody (NBP1-88007)

Learn more about PTMs related to NEK9 Antibody (NBP1-88007).
 

Research Areas for NEK9 Antibody (NBP1-88007)

Find related products by research area.

Blogs on NEK9

There are no specific blogs for NEK9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEK9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NEK9