NPHP4 Antibody - Azide and BSA Free

Western Blot: NPHP4 Antibody [NBP2-93637] - Analysis of extracts of various cell lines, using NPHP4 .Exposure time: 30s.

Immunocytochemistry/ Immunofluorescence: NPHP4 Antibody - Azide and BSA Free [NBP2-93637] - Immunofluorescence analysis of L929 cells using NPHP4 Rabbit pAb (A8934) at dilution of 100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: NPHP4 Antibody - Azide and BSA Free [NBP2-93637] - Immunofluorescence analysis of U2OS cells using NPHP4 Rabbit pAb (A8934) at dilution of 100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: NPHP4 Antibody - Azide and BSA Free [NBP2-93637] - Immunofluorescence analysis of H9C2 cells using NPHP4 Rabbit pAb (A8934) at dilution of 100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NPHP4 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit NPHP4 Antibody - Azide and BSA Free (NBP2-93637) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1247-1426 of human NPHP4 (NP_055917.1). RLSLVLRGTQTVRKVRAFTSHPQELKTDPKGVFVLPPRGVQDLHVGVRPLRAGSRFVHLNLVDVDCHQLVASWLVCLCCRQPLISKAFEIMLAAGEGKGVNKRITYTNPYPSRRTFHLHSDHPELLRFREDSFQVGGGETYTIGLQFAPSQRVGEEEILIYINDHEDKNEEAFCVKVIYQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NPHP4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Western Blot 1:1000 - 1:3000
• Theoretical MW: 158 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for NPHP4 Antibody - Azide and BSA Free

• FLJ46306
• KIAA0673nephrocystin-4
• nephrocystin 4
• nephronophthisis 4
• Nephroretinin
• POC10 centriolar protein homolog
• POC10
• SLSN4nephroretinin

Background

NPHP4 encodes a protein which contains a proline-rich region. The encoded protein may function in renal tubular development and function. This protein interacts with nephrocystin. Mutations in this gene are associated with nephronophthisis type 4. Multiple alternative transcript variants have been described but their full-length nature has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: NPHP4