NEDD1 Antibody (7D10)

Western Blot: NEDD1 Antibody (7D10) [H00121441-M05] - Western Blot analysis of NEDD1 expression in NIH/3T3 ( Cat # L018V1 ).

Immunohistochemistry-Paraffin: NEDD1 Antibody (7D10) [H00121441-M05] - Analysis of monoclonal antibody to NEDD1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 0.75 ug/ml

Western Blot: NEDD1 Antibody (7D10) [H00121441-M05] - Western Blot analysis of NEDD1 expression in Hela NE ( Cat # L013V3 ).

ELISA: NEDD1 Antibody (7D10) [H00121441-M05] - Detection limit for recombinant GST tagged NEDD1 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt, Po, Bv, Sh
• Applications: WB, ELISA, IB, ICC/IF, IHC, IHC-P, S-ELISA
• Clone: 7D10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

NEDD1 Antibody (7D10) Summary

• Immunogen: NEDD1 (NP_690869, 561 a.a. ~ 660 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNMIQETLDDFREACHRDIVNLQVEMIKQFHMQLNEMHSLLERYSVNEGLVAEIERLREENKRLRAHF
• Marker: Centrosome Marker
• Specificity: NEDD1 - neural precursor cell expressed, developmentally down-regulated 1
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NEDD1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunoblotting
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Sandwich ELISA
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 24025740).

Reactivity Notes

Other species have not been tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NEDD1 Antibody (7D10)

• FLJ35902
• GCP-WD
• NEDD-1
• Neural precursor cell expressed developmentally down-regulated protein 1
• neural precursor cell expressed, developmentally down-regulated 1
• protein NEDD1
• TUBGCP7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NEDD1 Antibody (H00121441-M05)(11)

Publications using H00121441-M05

• Baumann C, Wang X, Yang L, Viveiros MM. Error-prone meiotic division and subfertility in mice with oocyte-conditional knockdown of pericentrin. J. Cell. Sci. 2017 Feb 13 [PMID: 28193732] (Mouse)
• Uehara R, Kamasaki T, Hiruma S et al. Augmin shapes the anaphase spindle for efficient cytokinetic furrow ingression and abscission. Mol Biol Cell 2016 Mar 1 [PMID: 26764096] (WB)
• Lecland N, Luders J. The dynamics of microtubule minus ends in the human mitotic spindle. Nat Cell Biol. 2014 Jun 29 [PMID: 24976384]
• Tamura AN, Huang TT, Marikawa Y. Impact of Vitrification on the Meiotic Spindle and Components of the Microtubule-Organizing Center in Mouse Mature Oocytes. Biol Reprod. 2013 Sep 11 [PMID: 24025740] (ICC/IF, Mouse)
• Uehara R, Goshima G. Functional central spindle assembly requires de novo microtubule generation in the interchromosomal region during anaphase. Uehara R, Goshima G. J Cell Biol. [PMID: 20937700]
• Archinti M, Lacasa C, Teixido-Travesa N, Luders J. SPICE--a previously uncharacterized protein required for centriole duplication and mitotic chromosome congression. J Cell Sci 123(Pt 18):3039-46. 2010 Sep 15. [PMID: 20736305]
• Stiess M, Maghelli N, Kapitein LC et al. Axon extension occurs independently of centrosomal microtubule nucleation. Science 327(5966):704-7. 2010 Feb 5. [PMID: 20056854]
• Zhu H, Fang K, Fang G. FAM29A, a target of Plk1 regulation, controls the partitioning of NEDD1 between the mitotic spindle the centrosomes. J Cell Sci. 2009 Jul 13. [PMID: 19596795]
• Haren L, Stearns T, Luders J. Plk1-dependent recruitment of gamma-tubulin complexes to mitotic centrosomes involves multiple PCM components. PLoS One. 2009 Jun 19 [PMID: 19543530]
• Zhu H, Coppinger JA, Jang CY et al. FAM29A promotes microtubule amplification via recruitment of the NEDD1-gamma-tubulin complex to the mitotic spindle. J Cell Biol 183(5):835-48. 2008 Dec 1. [PMID: 19029337]
• Teixido-Travesa N, Villen J, Lacasa C et al. The {gamma}TuRC Revisited: A Comparative Analysis of Interphase and Mitotic Human {gamma}TuRC Redefines the Set of Core Components and Identifies the Novel Subunit GCP8. MBoC Sep 13 2010

Bioinformatics

• Gene Symbol: NEDD1
• Entrez:
  • 121441(Human)
• OMIM:
  • 600372(Human)
• Uniprot:
  • NP_690869(Human)