NEDD1 Antibody (7D10)

Images

 
Western Blot: NEDD1 Antibody (7D10) [H00121441-M05] - Western Blot analysis of NEDD1 expression in NIH/3T3 ( Cat # L018V1 ).
Immunohistochemistry-Paraffin: NEDD1 Antibody (7D10) [H00121441-M05] - Analysis of monoclonal antibody to NEDD1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 0.75 ug/ml
Western Blot: NEDD1 Antibody (7D10) [H00121441-M05] - Western Blot analysis of NEDD1 expression in Hela NE ( Cat # L013V3 ).
ELISA: NEDD1 Antibody (7D10) [H00121441-M05] - Detection limit for recombinant GST tagged NEDD1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, ShSpecies Glossary
Applications WB, ELISA, IB, ICC/IF, IHC, IHC-P, S-ELISA
Clone
7D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NEDD1 Antibody (7D10) Summary

Immunogen
NEDD1 (NP_690869, 561 a.a. ~ 660 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNMIQETLDDFREACHRDIVNLQVEMIKQFHMQLNEMHSLLERYSVNEGLVAEIERLREENKRLRAHF
Marker
Centrosome Marker
Specificity
NEDD1 - neural precursor cell expressed, developmentally down-regulated 1
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NEDD1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunoblotting
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 24025740).
Publications
Read Publications using
H00121441-M05 in the following applications:

Reactivity Notes

Other species have not been tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NEDD1 Antibody (7D10)

  • FLJ35902
  • GCP-WD
  • NEDD-1
  • Neural precursor cell expressed developmentally down-regulated protein 1
  • neural precursor cell expressed, developmentally down-regulated 1
  • protein NEDD1
  • TUBGCP7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56651
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-61071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00027349-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-84634
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53097
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-93107
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP2-59027
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88795
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB333
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-42849
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP2-16628
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-16416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00091754-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-47865
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31110
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-563
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
H00121441-M05
Species: Hu, Mu, Rt, Po, Bv, Sh
Applications: WB, ELISA, IB, ICC/IF, IHC, IHC-P, S-ELISA

Publications for NEDD1 Antibody (H00121441-M05)(11)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(2)
All Species
Showing Publications 1 - 10 of 11. Show All 11 Publications.
Publications using H00121441-M05 Applications Species
Baumann C, Wang X, Yang L, Viveiros MM. Error-prone meiotic division and subfertility in mice with oocyte-conditional knockdown of pericentrin. J. Cell. Sci. 2017 Feb 13 [PMID: 28193732] (Mouse) Mouse
Uehara R, Kamasaki T, Hiruma S et al. Augmin shapes the anaphase spindle for efficient cytokinetic furrow ingression and abscission. Mol Biol Cell 2016 Mar 1 [PMID: 26764096] (WB) WB
Lecland N, Luders J. The dynamics of microtubule minus ends in the human mitotic spindle. Nat Cell Biol. 2014 Jun 29 [PMID: 24976384]
Tamura AN, Huang TT, Marikawa Y. Impact of Vitrification on the Meiotic Spindle and Components of the Microtubule-Organizing Center in Mouse Mature Oocytes. Biol Reprod. 2013 Sep 11 [PMID: 24025740] (ICC/IF, Mouse) ICC/IF Mouse
Uehara R, Goshima G. Functional central spindle assembly requires de novo microtubule generation in the interchromosomal region during anaphase. Uehara R, Goshima G. J Cell Biol. [PMID: 20937700]
Archinti M, Lacasa C, Teixido-Travesa N, Luders J. SPICE--a previously uncharacterized protein required for centriole duplication and mitotic chromosome congression. J Cell Sci 123(Pt 18):3039-46. 2010 Sep 15. [PMID: 20736305]
Stiess M, Maghelli N, Kapitein LC et al. Axon extension occurs independently of centrosomal microtubule nucleation. Science 327(5966):704-7. 2010 Feb 5. [PMID: 20056854]
Zhu H, Fang K, Fang G. FAM29A, a target of Plk1 regulation, controls the partitioning of NEDD1 between the mitotic spindle the centrosomes. J Cell Sci. 2009 Jul 13. [PMID: 19596795]
Haren L, Stearns T, Luders J. Plk1-dependent recruitment of gamma-tubulin complexes to mitotic centrosomes involves multiple PCM components. PLoS One. 2009 Jun 19 [PMID: 19543530]
Zhu H, Coppinger JA, Jang CY et al. FAM29A promotes microtubule amplification via recruitment of the NEDD1-gamma-tubulin complex to the mitotic spindle. J Cell Biol 183(5):835-48. 2008 Dec 1. [PMID: 19029337]
Show All 11 Publications.

Reviews for NEDD1 Antibody (H00121441-M05) (0)

There are no reviews for NEDD1 Antibody (H00121441-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NEDD1 Antibody (H00121441-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NEDD1 Products

Array H00121441-M05

Bioinformatics Tool for NEDD1 Antibody (H00121441-M05)

Discover related pathways, diseases and genes to NEDD1 Antibody (H00121441-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEDD1 Antibody (H00121441-M05)

Discover more about diseases related to NEDD1 Antibody (H00121441-M05).
 

Pathways for NEDD1 Antibody (H00121441-M05)

View related products by pathway.

PTMs for NEDD1 Antibody (H00121441-M05)

Learn more about PTMs related to NEDD1 Antibody (H00121441-M05).

Blogs on NEDD1

There are no specific blogs for NEDD1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEDD1 Antibody (7D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol NEDD1
Entrez
OMIM
Uniprot