NEDD1 Antibody (7D10)

Western Blot: NEDD1 Antibody (7D10) [H00121441-M05] - Western Blot analysis of NEDD1 expression in NIH/3T3 ( Cat # L018V1 ).

Immunohistochemistry-Paraffin: NEDD1 Antibody (7D10) [H00121441-M05] - Analysis of monoclonal antibody to NEDD1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 0.75 ug/ml

Western Blot: NEDD1 Antibody (7D10) [H00121441-M05] - Western Blot analysis of NEDD1 expression in Hela NE ( Cat # L013V3 ).

ELISA: NEDD1 Antibody (7D10) [H00121441-M05] - Detection limit for recombinant GST tagged NEDD1 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt, Po, Bv, Sh
• Applications: WB, ELISA, ICC/IF, IHC, WB
• Clone: 7D10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

NEDD1 Antibody (7D10) Summary

• Immunogen: NEDD1 (NP_690869, 561 a.a. ~ 660 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNMIQETLDDFREACHRDIVNLQVEMIKQFHMQLNEMHSLLERYSVNEGLVAEIERLREENKRLRAHF
• Marker: Centrosome Marker
• Specificity: NEDD1 - neural precursor cell expressed, developmentally down-regulated 1
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NEDD1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunoblotting
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 24025740).

Reactivity Notes

Other species have not been tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NEDD1 Antibody (7D10)

• FLJ35902
• GCP-WD
• NEDD-1
• Neural precursor cell expressed developmentally down-regulated protein 1
• neural precursor cell expressed, developmentally down-regulated 1
• protein NEDD1
• TUBGCP7

Background

NEDD1 is required for mitosis progression. Promotes the nucleation of microtubules from the spindle

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NEDD1 Antibody (H00121441-M05)(13)

Publications using H00121441-M05

• Krystal P, Jacopo S, Isabelle V et al. NEDD1-S411 phosphorylation plays a critical function in the coordination of microtubule nucleation during mitosis. Biol Open. 2022-10-31 [PMID: 36318115]
• Isabell S, Marta R, M H et al. Dual spindles assemble in bovine zygotes despite the presence of paternal centrosomes. J Cell Biol. 2021-09-22 [PMID: 34550316]
• Baumann C, Wang X, Yang L, Viveiros MM. Error-prone meiotic division and subfertility in mice with oocyte-conditional knockdown of pericentrin. J. Cell. Sci. 2017-02-13 [PMID: 28193732] (Mouse)
• Uehara R, Kamasaki T, Hiruma S et al. Augmin shapes the anaphase spindle for efficient cytokinetic furrow ingression and abscission. Mol Biol Cell 2016-03-01 [PMID: 26764096] (WB)
• Lecland N, Luders J. The dynamics of microtubule minus ends in the human mitotic spindle. Nat Cell Biol. 2014-06-29 [PMID: 24976384]
• Tamura AN, Huang TT, Marikawa Y. Impact of Vitrification on the Meiotic Spindle and Components of the Microtubule-Organizing Center in Mouse Mature Oocytes. Biol Reprod. 2013-09-11 [PMID: 24025740] (ICC/IF, Mouse)
• Uehara R, Goshima G. Functional central spindle assembly requires de novo microtubule generation in the interchromosomal region during anaphase. Uehara R, Goshima G. [PMID: 20937700]
• Teixido-Travesa N, Villen J, Lacasa C et al. The {gamma}TuRC Revisited: A Comparative Analysis of Interphase and Mitotic Human {gamma}TuRC Redefines the Set of Core Components and Identifies the Novel Subunit GCP8. Mol Biol Cell 2010-09-24 [PMID: 20861304]
• Archinti M, Lacasa C, Teixido-Travesa N, Luders J. SPICE--a previously uncharacterized protein required for centriole duplication and mitotic chromosome congression. J Cell Sci 123(Pt 18):3039-46. 2010-09-15 [PMID: 20736305]
• Stiess M, Maghelli N, Kapitein LC et al. Axon extension occurs independently of centrosomal microtubule nucleation. Science 327(5966):704-7. 2010-02-05 [PMID: 20056854]
• Zhu H, Fang K, Fang G. FAM29A, a target of Plk1 regulation, controls the partitioning of NEDD1 between the mitotic spindle the centrosomes. J Cell Sci. 2009-07-13 [PMID: 19596795]
• Haren L, Stearns T, Luders J. Plk1-dependent recruitment of gamma-tubulin complexes to mitotic centrosomes involves multiple PCM components. PLoS One. 2009-06-19 [PMID: 19543530]
• Zhu H, Coppinger JA, Jang CY et al. FAM29A promotes microtubule amplification via recruitment of the NEDD1-gamma-tubulin complex to the mitotic spindle. J Cell Biol 2008-12-01 [PMID: 19029337]

Bioinformatics

• Gene Symbol: NEDD1
• Entrez:
  • 121441(Human)
• OMIM:
  • 600372(Human)
• Uniprot:
  • NP_690869(Human)