NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody - BSA Free

Western Blot: NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody [NBP3-09381] - Western blot analysis of NEDD8 Activating Enzyme (APPBP1/UBA3) in Mouse Lung lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody - BSA Free (NBP3-09381) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse NEDD8 Activating Enzyme (APPBP1/UBA3) (NP_659180). Peptide sequence ARALKEFVAKEGQGNLPVRGTIPDMIADSNKYIKLQNVYREKAKKDAAAV
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NAE1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 60 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody - BSA Free

• A-116A10.1
• amyloid beta precursor protein binding protein 1
• amyloid beta precursor protein binding protein 1, 59kDa
• Amyloid beta precursor protein-binding protein 1, 59 kDa
• amyloid beta precursor protein-binding protein 1, 59kD
• Amyloid protein-binding protein 1
• APPBP1/UBA3 Complex
• APPBP1APP-BP1
• NEDD8 activating enzyme E1 subunit 1
• NEDD8-activating enzyme E1 regulatory subunit
• NEDD8-activating enzyme E1 subunit
• protooncogene protein 1
• Proto-oncogene protein 1
• ula-1

Background

NAE1 is encoded by this gene binds to the beta-amyloid precursor protein. Beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. In addition, the encoded protein can form a heterodimer with UBE1C and bind and activate NEDD8, a ubiquitin-like protein. This protein is required for cell cycle progression through the S/M checkpoint. Three transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NAE1