Nectin-2/CD112 Antibody - BSA Free

Immunohistochemistry-Paraffin: Nectin-2/CD112 Antibody [NBP1-91211] - Staining in human placenta and cerebral cortex tissues . Corresponding NECTIN2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Nectin-2/CD112 Antibody [NBP1-91211] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: Nectin-2/CD112 Antibody [NBP1-91211] - Staining of human liver shows moderate membranous positivity in hepatocytes.

Immunohistochemistry-Paraffin: Nectin-2/CD112 Antibody [NBP1-91211] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: Nectin-2/CD112 Antibody [NBP1-91211] - Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.

Analysis in human placenta and cerebral cortex tissues using NBP1-91211 antibody. Corresponding NECTIN2 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Nectin-2/CD112 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NECTIN2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Nectin-2/CD112 Protein (NBP1-91211PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Nectin-2/CD112 Antibody - BSA Free

• CD112 antigen
• CD112
• Herpes virus entry mediator B
• Herpesvirus entry mediator B
• herpesvirus entry protein B
• HVEB
• HVEBpoliovirus receptor-like 2
• MPH
• nectin 2
• Nectin2
• Nectin-2
• poliovirus receptor-related 2 (herpesvirus entry mediator B)
• poliovirus receptor-related protein 2
• PRR2
• PRR2nectin-2
• PVRL2
• PVRR2poliovirus receptor related 2

Background

Nectin 2 encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions. It also serves as an entry for certain mutant strains of herpes simplex virus and pseudorabies virus, and it is involved in cell to cell spreading of these viruses. Variations in this gene have been associated with differences in the severity of multiple sclerosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Nectin-2/CD112 Antibody (NBP1-91211)(1)

Publication using NBP1-91211

• Bekes I, Lob S, Holzheu I, et al. Nectin-2 in ovarian cancer: How is it expressed and what might be its functional role? Cancer Sci. 2019-05-02 [PMID: 30843637] (IHC-P, Human)

Bioinformatics

• Gene Symbol: NECTIN2