NECAB3 Antibody - BSA Free

Western Blot: NECAB3 Antibody [NBP1-56552] - Hela cell lysate, concentration 0.2-1 ug/ml.

Western Blot: NECAB3 Antibody [NBP1-56552] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 312500 Positive control: Hela cell lysate NECAB3 is supported by BioGPS gene expression data to be expressed in HeLa.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NECAB3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to NECAB3 (N-terminal EF-hand calcium binding protein 3) The peptide sequence was selected from the middle region of NECAB3)(50ug). Peptide sequence ESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NECAB3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NECAB3 Antibody - BSA Free

• Amyloid beta A4 protein-binding family A member 2-binding protein
• APBA2BPfamily A, member 2 binding protein
• dJ63M2.4
• dJ63M2.5
• EFCBP3STIP3
• EF-hand calcium binding protein 3
• Neuronal calcium-binding protein 3
• neuronal calcium-binding protein NECAB3
• NIP1Nek2-interacting protein 1
• N-terminal EF-hand calcium binding protein 3
• N-terminal EF-hand calcium-binding protein 3
• synaptotagmin interacting protein 2
• synaptotagmin interacting protein STIP3
• SYTIP2
• XB51X11L-binding protein 51

Background

The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NECAB3