EFCBP2 Antibody

Images

 
Western Blot: EFCBP2 Antibody [NBP1-84002] - Analysis in mouse cerebral cortex tissue.
Immunocytochemistry/ Immunofluorescence: EFCBP2 Antibody [NBP1-84002] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry: EFCBP2 Antibody [NBP1-84002] - Staining of human lateral ventricle wall shows moderate positivity in neuropil and cytoplasmic staining in some neurons.
Western Blot: EFCBP2 Antibody [NBP1-84002] - Analysis in human cerebral cortex tissue.
Immunocytochemistry/ Immunofluorescence: EFCBP2 Antibody [NBP1-84002] - Staining mouse hippocampus shows immunoreactivity in a subset of neurons.
Immunocytochemistry/ Immunofluorescence: EFCBP2 Antibody [NBP1-84002] - Staining mouse caudate putamen shows immunoreactivity in medium spiny neurons and synapses.
Immunocytochemistry/ Immunofluorescence: EFCBP2 Antibody [NBP1-84002] - Staining mouse facial nucleus shows distinct positivity in neuronal cell bodies and processes.
Immunocytochemistry/ Immunofluorescence: EFCBP2 Antibody [NBP1-84002] - Staining mouse midbrain shows neuronal positivity in dorsal raphe.
Immunohistochemistry: EFCBP2 Antibody [NBP1-84002] - Staining of human lateral ventricle shows distinct cytoplasmic positivity in neuronal cells.
Immunohistochemistry: EFCBP2 Antibody [NBP1-84002] - Staining in human hippocampus shows strong cycoplasmic postitivity in subset of neurons.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EFCBP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VILDIFRRADKNDDGKLSLEEFQLFFADGVLNEKELEDLFHTIDSDNTNHVDTKELCDYFVDHMGDYEDVLASLETLNHSVLKAMGYTKKVYEGGSNVDQFVTRFLLKETANQIQSLLSSVESAVEAIEEQTSQL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NECAB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EFCBP2 Protein (NBP1-84002PEP)
Publications
Read Publication using NBP1-84002.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24616509)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EFCBP2 Antibody

  • EF-hand calcium binding protein 2
  • N-terminal EF-hand calcium binding protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84004
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55136
Species: Hu
Applications: ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB4514
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NLS418
Species: Hu
Applications: IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
H00006496-M04
Species: Hu
Applications: WB, ELISA
AF1979
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-37619
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
H00002316-M01
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
NBP1-39474
Species: Hu, Mu, Rt, Po, Ca, GP, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NB100-56467
Species: Hu, Ca, Pm
Applications: WB
NBP1-84002
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for EFCBP2 Antibody (NBP1-84002)(1)

Reviews for EFCBP2 Antibody (NBP1-84002) (0)

There are no reviews for EFCBP2 Antibody (NBP1-84002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EFCBP2 Antibody (NBP1-84002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EFCBP2 Products

Bioinformatics Tool for EFCBP2 Antibody (NBP1-84002)

Discover related pathways, diseases and genes to EFCBP2 Antibody (NBP1-84002). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EFCBP2 Antibody (NBP1-84002)

Discover more about diseases related to EFCBP2 Antibody (NBP1-84002).
 

Pathways for EFCBP2 Antibody (NBP1-84002)

View related products by pathway.

Blogs on EFCBP2

There are no specific blogs for EFCBP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EFCBP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NECAB2