EFCBP2 Antibody - BSA Free

Immunohistochemistry-Paraffin: EFCBP2 Antibody [NBP1-84002] - Staining in human cerebral cortex and skin tissues using NBP1-84002 antibody. Corresponding NECAB2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: EFCBP2 Antibody [NBP1-84002] - Staining of human cerebral cortex, kidney, pancreas and skin using Anti-NECAB2 antibody NBP1-84002 (A) shows similar protein distribution across tissues to independent antibody NBP1-84001 (B).

Immunocytochemistry/Immunofluorescence: EFCBP2 Antibody [NBP1-84002] - Staining of human cell line U-2 OS shows localization to vesicles.

Immunohistochemistry-Paraffin: EFCBP2 Antibody [NBP1-84002] - Staining of human kidney shows no positivity in cells in tubules as expected.

Immunohistochemistry: EFCBP2 Antibody [NBP1-84002] - Staining mouse hippocampus shows immunoreactivity in a subset of neurons.

Immunohistochemistry: EFCBP2 Antibody [NBP1-84002] - Staining mouse caudate putamen shows immunoreactivity in medium spiny neurons and synapses.

Immunohistochemistry: EFCBP2 Antibody [NBP1-84002] - Staining mouse facial nucleus shows distinct positivity in neuronal cell bodies and processes.

Immunohistochemistry: EFCBP2 Antibody [NBP1-84002] - Staining mouse midbrain shows neuronal positivity in dorsal raphe.

Immunohistochemistry-Paraffin: EFCBP2 Antibody [NBP1-84002] - Staining of human cerebral cortex shows moderate positivity in neuropil.

Immunohistochemistry-Paraffin: EFCBP2 Antibody [NBP1-84002] - Staining of human pancreas shows weak cytoplasmic positivity in islets of Langerhans.

Immunohistochemistry-Paraffin: EFCBP2 Antibody [NBP1-84002] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

Analysis in human cerebral cortex tissue.

Analysis in mouse cerebral cortex tissue.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EFCBP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EFCBP2 Antibody - BSA Free (NBP1-84002) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-EFCBP2 Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VILDIFRRADKNDDGKLSLEEFQLFFADGVLNEKELEDLFHTIDSDNTNHVDTKELCDYFVDHMGDYEDVLASLETLNHSVLKAMGYTKKVYEGGSNVDQFVTRFLLKETANQIQSLLSSVESAVEAIEEQTSQL
• Predicted Species: Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NECAB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  EFCBP2 Protein (NBP1-84002PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EFCBP2 Antibody - BSA Free

• EF-hand calcium binding protein 2
• N-terminal EF-hand calcium binding protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EFCBP2 Antibody (NBP1-84002)(5)

Publications using NBP1-84002

• Pannoni KE, Fischer QS, Tarannum R et al. The mitochondrial calcium uniporter is necessary for synaptic plasticity and proper mitochondrial morphology and distribution in the distal dendrites of CA2 neurons bioRxiv : the preprint server for biology 2023-11-11 [PMID: 37986798] (IHC, Mouse)
• Dudek SM, Phoenix AN, Scappini E et al. Defining hippocampal area CA2 in the fox (Vulpes vulpes) brain Hippocampus 2023-06-01 [PMID: 37159095] (WB)
• Laham BJ, Diethorn EJ, Gould E Newborn mice form lasting CA2-dependent memories of their mothers Cell reports 2021-01-26 [PMID: 33503421] (Mouse)
• Farris S, Ward JM, Carstens KE et al. Hippocampal Subregions Express Distinct Dendritic Transcriptomes that Reveal Differences in Mitochondrial Function in CA2 Cell Rep 2019-10-08 [PMID: 31597108] (IHC-P, Mouse)
• Zhang MD, Tortoriello G, Hsueh B et al. Neuronal calcium-binding proteins 1/2 localize to dorsal root ganglia and excitatory spinal neurons and are regulated by nerve injury. Proc Natl Acad Sci U S A 2014-03-25 [PMID: 24616509]

Bioinformatics

• Gene Symbol: NECAB2