NECAB1 Antibody - BSA Free

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Analysis in human cerebral cortex and liver tissues. Corresponding NECAB1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of human cerebral cortex, colon, liver and pancreas using Anti-NECAB1 antibody NBP1-84004 (A) shows similar protein distribution across tissues to independent antibody NBP1-84003 (B).

Western Blot: NECAB1 Antibody [NBP1-84004] - Analysis using Anti-NECAB1 antibody NBP1-84004 (A) shows similar pattern to independent antibody NBP1-84003 (B).

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of human pancreas.

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of human liver shows not positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of human colon shows no positivityin glandular cells as expected.

Immunohistochemistry: NECAB1 Antibody [NBP1-84004] - Staining of mouse parietal association cortex shows distinct positivity in layer 4 neurons.

Immunohistochemistry: NECAB1 Antibody [NBP1-84004] - Staining of mouse hippocampus shows immunoreactivity in a subset of interneurons.

Immunohistochemistry: NECAB1 Antibody [NBP1-84004] - Staining of mouse superior colliculi shows positivity in a subset of neurons.

Immunohistochemistry: NECAB1 Antibody [NBP1-84004] - Staining of mouse vestibular nucleus shows immunoreactivity in a subset of neurons.

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NECAB1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NECAB1 Antibody - BSA Free (NBP1-84004) is a polyclonal antibody validated for use in IHC and WB. Anti-NECAB1 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSP
• Predicted Species: Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NECAB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NECAB1 Protein (NBP1-84004PEP)

Reactivity Notes

Reactivity in mouse reported in scientific literature (PMID: 24616509)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NECAB1 Antibody - BSA Free

• EF hand calcium binding protein 1
• EFCBP1
• EF-hand calcium binding protein 1
• EF-hand calcium-binding protein 1
• neuronal calcium binding protein
• Neuronal calcium-binding protein 1
• N-terminal EF-hand calcium binding protein 1
• N-terminal EF-hand calcium-binding protein 1
• STIP-1
• synaptotagmin interacting protein 1

Background

The NECAB1 gene codes for a N-terminal EF-hand calcium-binding protein 1 that in isoform 1 is 351 amino acids long and 40 kDA and in isoform 2 is 100 amino acids long at 11 kDA. NECAB1 has been linked to diseases such as seizures, schizophrenia, alzheimer's disease, motor neuron disease, neuronitis, and neurodegenerative disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NECAB1 Antibody (NBP1-84004)(3)

Publications using NBP1-84004

• Aquiles A, Fiordelisio T, Luna-Munguia H, Concha L. Altered functional connectivity and network excitability in a model of cortical dysplasia Scientific Reports 2023-07-30 [PMID: 37518675]
• Jgamadze D, Lim J, Zhang Z et al. Structural and functional integration of human forebrain organoids with the injured adult rat visual system Cell Stem Cell 2023-02-01 [PMID: 36736289] (IHC-Fr)
  
  Details:
  Organoids of human origen, grafted into Rats
• Zhang MD, Tortoriello G, Hsueh B et al. Neuronal calcium-binding proteins 1/2 localize to dorsal root ganglia and excitatory spinal neurons and are regulated by nerve injury. Proc Natl Acad Sci U S A 2014-03-25 [PMID: 24616509]

Bioinformatics

• Gene Symbol: NECAB1