NECAB1 Antibody


Western Blot: NECAB1 Antibody [NBP1-84004] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue
Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of human lateral ventricle shows moderate cytoplasmic and nuclear positivity in neuronal cells.
Western Blot: NECAB1 Antibody [NBP1-84004] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Western Blot: NECAB1 Antibody [NBP1-84004] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of mouse parietal association cortex shows distinct positivity in layer 4 neurons.
Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of mouse hippocampus shows immunoreactivity in a subset of interneurons.
Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of mouse superior colliculi shows positivity in a subset of neurons.
Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of mouse vestibular nucleus shows immunoreactivity in a subset of neurons.
Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of human cerebral cortex shows strong positivity in subsets of neurons.
Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84004] - Staining of human hippocampus shows nuclear and cytoplasmic positivity in neurons.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

NECAB1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSP
Specificity of human, mouse NECAB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NECAB1 Protein (NBP1-84004PEP)
Read Publication using NBP1-84004.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24616509)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NECAB1 Antibody

  • EF hand calcium binding protein 1
  • EFCBP1
  • EF-hand calcium binding protein 1
  • EF-hand calcium-binding protein 1
  • neuronal calcium binding protein
  • Neuronal calcium-binding protein 1
  • N-terminal EF-hand calcium binding protein 1
  • N-terminal EF-hand calcium-binding protein 1
  • STIP-1
  • synaptotagmin interacting protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Po, Ca, GP, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NECAB1 Antibody (NBP1-84004)(1)

Reviews for NECAB1 Antibody (NBP1-84004) (0)

There are no reviews for NECAB1 Antibody (NBP1-84004). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NECAB1 Antibody (NBP1-84004) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NECAB1 Products

Bioinformatics Tool for NECAB1 Antibody (NBP1-84004)

Discover related pathways, diseases and genes to NECAB1 Antibody (NBP1-84004). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NECAB1 Antibody (NBP1-84004)

Discover more about diseases related to NECAB1 Antibody (NBP1-84004).

Pathways for NECAB1 Antibody (NBP1-84004)

View related products by pathway.

Blogs on NECAB1

There are no specific blogs for NECAB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NECAB1 Antibody and receive a gift card or discount.


Gene Symbol NECAB1