NECAB1 Antibody - BSA Free

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP2-33949] - Staining in human cerebral cortex and pancreas tissues using anti-NECAB1 antibody. Corresponding NECAB1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP2-33949] - Staining of human cerebral cortex, colon, liver and pancreas using Anti-NECAB1 antibody NBP2-33949 (A) shows similar protein distribution across tissues to independent antibody NBP1-84004 (B).

Western Blot: NECAB1 Antibody [NBP2-33949] - Analysis NBP2-33949 (A) shows similar pattern to independent antibody NBP1-84004 (B).

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP2-33949] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP2-33949] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP2-33949] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP2-33949] - Staining of human colon.

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP2-33949] - Staining of human liver.

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP2-33949] - Analysis in human cerebral cortex and liver tissues. Corresponding NECAB1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP2-33949] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP2-33949] - Staining of human colon shows no positivity in glandular cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NECAB1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEEFKAYFADGVLSGEELHELFH
• Predicted Species: Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NECAB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NECAB1 Protein (NBP2-33949PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26076492).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NECAB1 Antibody - BSA Free

• EF hand calcium binding protein 1
• EFCBP1
• EF-hand calcium binding protein 1
• EF-hand calcium-binding protein 1
• neuronal calcium binding protein
• Neuronal calcium-binding protein 1
• N-terminal EF-hand calcium binding protein 1
• N-terminal EF-hand calcium-binding protein 1
• STIP-1
• synaptotagmin interacting protein 1

Background

The NECAB1 gene codes for a N-terminal EF-hand calcium-binding protein 1 that in isoform 1 is 351 amino acids long and 40 kDA and in isoform 2 is 100 amino acids long at 11 kDA. NECAB1 has been linked to diseases such as seizures, schizophrenia, alzheimer's disease, motor neuron disease, neuronitis, and neurodegenerative disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NECAB1 Antibody (NBP2-33949)(1)

Publication using NBP2-33949

• Sjostedt E, Fagerberg L, Hallstrom BM et al. Defining the Human Brain Proteome Using Transcriptomics and Antibody-Based Profiling with a Focus on the Cerebral Cortex. PLoS One 2015-01-01 [PMID: 26076492] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: NECAB1
• Uniprot:
  • Q8N987(Human)