NECAB1 Antibody

Images

 
Western Blot: NECAB1 Antibody [NBP1-84005] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue
Immunocytochemistry/ Immunofluorescence: NECAB1 Antibody [NBP1-84005] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84005] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal cells.
Western Blot: NECAB1 Antibody [NBP1-84005] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Western Blot: NECAB1 Antibody [NBP1-84005] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NECAB1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PGLLEEDNQWMTQINRLQKLIDRLEKKDLKLEPPEEEIIEGNTKSHIMLVQRQMSVIEEDLEEFQLALKHYVE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NECAB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NECAB1 Protein (NBP1-84005PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NECAB1 Antibody

  • EF hand calcium binding protein 1
  • EFCBP1
  • EF-hand calcium binding protein 1
  • EF-hand calcium-binding protein 1
  • neuronal calcium binding protein
  • Neuronal calcium-binding protein 1
  • N-terminal EF-hand calcium binding protein 1
  • N-terminal EF-hand calcium-binding protein 1
  • STIP-1
  • synaptotagmin interacting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
NBP2-30049
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP1-84002
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55136
Species: Hu
Applications: ICC/IF
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NB120-11427
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00003208-B01P
Species: Hu
Applications: WB, ICC/IF
NLS418
Species: Hu
Applications: IHC-P
NBP1-40364
Species: Hu
Applications: WB, IHC, IP
NBP1-39474
Species: Hu, Mu, Rt, Po, Ca, GP, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-88219
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-84005
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NECAB1 Antibody (NBP1-84005) (0)

There are no publications for NECAB1 Antibody (NBP1-84005).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NECAB1 Antibody (NBP1-84005) (0)

There are no reviews for NECAB1 Antibody (NBP1-84005). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NECAB1 Antibody (NBP1-84005) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NECAB1 Products

Bioinformatics Tool for NECAB1 Antibody (NBP1-84005)

Discover related pathways, diseases and genes to NECAB1 Antibody (NBP1-84005). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NECAB1 Antibody (NBP1-84005)

Discover more about diseases related to NECAB1 Antibody (NBP1-84005).
 

Pathways for NECAB1 Antibody (NBP1-84005)

View related products by pathway.

Blogs on NECAB1

There are no specific blogs for NECAB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NECAB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NECAB1