NECAB1 Antibody - BSA Free

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84005] - Analysis in human cerebral cortex and liver tissues. Corresponding NECAB1 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: NECAB1 Antibody [NBP1-84005] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & cytosol.

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84005] - Staining of human liver shows no positivity in hepatocytes.

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84005] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: NECAB1 Antibody [NBP1-84005] - Staining of human colon shows no positivity in glandular cells.

Staining of human pancreas shows no positivity in exocrine glandular cells.

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Mouse Cerebral Cortex tissue

Analysis in control (vector only transfected HEK293T lysate) and NECAB1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NECAB1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PGLLEEDNQWMTQINRLQKLIDRLEKKDLKLEPPEEEIIEGNTKSHIMLVQRQMSVIEEDLEEFQLALKHYVE
• Predicted Species: Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NECAB1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NECAB1 Protein (NBP1-84005PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NECAB1 Antibody - BSA Free

• EF hand calcium binding protein 1
• EFCBP1
• EF-hand calcium binding protein 1
• EF-hand calcium-binding protein 1
• neuronal calcium binding protein
• Neuronal calcium-binding protein 1
• N-terminal EF-hand calcium binding protein 1
• N-terminal EF-hand calcium-binding protein 1
• STIP-1
• synaptotagmin interacting protein 1

Background

The NECAB1 gene codes for a N-terminal EF-hand calcium-binding protein 1 that in isoform 1 is 351 amino acids long and 40 kDA and in isoform 2 is 100 amino acids long at 11 kDA. NECAB1 has been linked to diseases such as seizures, schizophrenia, alzheimer's disease, motor neuron disease, neuronitis, and neurodegenerative disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NECAB1