NDUFV2 Antibody - BSA Free

Western Blot: NDUFV2 Antibody [NBP1-79680] - Mouse Brain Lysate 1ug/ml Gel Concentration 10-20%

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NDUFV2 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the C terminal of human Ndufv2The immunogen for this antibody is Ndufv2. Peptide sequence DNYYEDLTPKDIEEIIDELKAGKVPKPGPRSGRFCCEPAGGLTSLTEPPK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFV2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NDUFV2 Antibody - BSA Free

• CI-24k
• mitochondrial respitory chain, 24 kD subunit
• NADH dehydrogenase (ubiquinone) flavoprotein 2 (24kD)
• NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa
• NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
• NADH dehydrogenase ubiquinone flavoprotein 2, mitochondrial
• NADH-ubiquinone oxidoreductase 24 kDa subunit
• NADH-ubiquinone oxidoreductase flavoprotein 2
• nuclear-encoded mitochondrial NADH-ubiquinone reductase 24Kd subunit

Background

NDUFV2 is the core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Complex I is composed of 45 different subunits. This is a component of the flavoprotein-sulfur (FP) fragment of the enzyme.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFV2
• Uniprot:
  • NP_082664(Mouse)