NDUFV1 Antibody


Western Blot: NDUFV1 Antibody [NBP1-54780] - Fetal liver Cell lysates, Antibody Dilution: 1.0 ug/ml.
Western Blot: NDUFV1 Antibody [NBP1-54780] - Titration: 2.5ug/ml Positive Control: HepG2 cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

NDUFV1 Antibody Summary

Synthetic peptides corresponding to NDUFV1(NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa) The peptide sequence was selected from the N terminal of NDUFV1. Peptide sequence FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NDUFV1 and was validated on Western blot.
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
NDUFV1 Lysate (NBP2-65846)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NDUFV1 Antibody

  • CI-51K
  • CI51KD
  • CI-51kD
  • complex I 51kDa subunit
  • complex I, mitochondrial respiratory chain
  • Complex I-51kD
  • EC
  • EC
  • EC
  • FLJ59059
  • mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1
  • NADH dehydrogenase (ubiquinone) flavoprotein 1 (51kD)
  • NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa
  • NADH dehydrogenase flavoprotein 1
  • NADH-ubiquinone oxidoreductase 51 kDa subunit
  • UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial


NDUFV1 is the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.The NDUFV1 gene encodes the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, Block
Species: Multi
Applications: WB, Simple Western, ICC
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for NDUFV1 Antibody (NBP1-54780) (0)

There are no publications for NDUFV1 Antibody (NBP1-54780).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFV1 Antibody (NBP1-54780) (0)

There are no reviews for NDUFV1 Antibody (NBP1-54780). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFV1 Antibody (NBP1-54780) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional NDUFV1 Products

Bioinformatics Tool for NDUFV1 Antibody (NBP1-54780)

Discover related pathways, diseases and genes to NDUFV1 Antibody (NBP1-54780). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFV1 Antibody (NBP1-54780)

Discover more about diseases related to NDUFV1 Antibody (NBP1-54780).

Pathways for NDUFV1 Antibody (NBP1-54780)

View related products by pathway.

PTMs for NDUFV1 Antibody (NBP1-54780)

Learn more about PTMs related to NDUFV1 Antibody (NBP1-54780).

Blogs on NDUFV1

There are no specific blogs for NDUFV1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NDUFV1 Antibody and receive a gift card or discount.


Gene Symbol NDUFV1