NDUFV1 Antibody - BSA Free

Western Blot: NDUFV1 Antibody [NBP1-54780] - Fetal liver Cell lysates, Antibody Dilution: 1.0 ug/ml.

Western Blot: NDUFV1 Antibody [NBP1-54780] - Titration: 2.5ug/ml Positive Control: HepG2 cell lysate.

Product Discontinued

NDUFV1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to NDUFV1(NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa) The peptide sequence was selected from the N terminal of NDUFV1. Peptide sequence FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFV1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 51 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for NDUFV1 Antibody - BSA Free

• CI-51K
• CI51KD
• CI-51kD
• complex I 51kDa subunit
• complex I, mitochondrial respiratory chain
• Complex I-51kD
• EC 1.6.5.3
• EC 1.6.99.3
• EC 1.6.99.5
• FLJ59059
• mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1
• NADH dehydrogenase (ubiquinone) flavoprotein 1 (51kD)
• NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa
• NADH dehydrogenase flavoprotein 1
• NADH-ubiquinone oxidoreductase 51 kDa subunit
• UQOR1NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

Background

NDUFV1 is the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.The NDUFV1 gene encodes the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFV1
• Uniprot:
  • P49821(Human)