Ndufs1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Ndufs1 Antibody [NBP3-35706] - Immunofluorescence analysis of HeLa cells using Ndufs1 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Ndufs1 Antibody [NBP3-35706] - Immunofluorescence analysis of HepG2 cells using Ndufs1 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Ndufs1 Antibody [NBP3-35706] - Immunofluorescence analysis of NIH/3T3 cells using Ndufs1 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: Ndufs1 Antibody [NBP3-35706] - Western blot analysis of various lysates using Ndufs1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

Immunohistochemistry: Ndufs1 Antibody [NBP3-35706] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using Ndufs1 Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Ndufs1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Ndufs1 Antibody - BSA Free (NBP3-35706) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-290 of human Ndufs1 (NP_004997.4).
  
  Sequence:
  VEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 79 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Ndufs1 Antibody - BSA Free

• CI-75k
• CI-75kD
• complex I 75kDa subunit
• complex I, mitochondrial respiratory chain, 75-kD subunit
• Complex I-75kD
• EC 1.6.5.3
• EC 1.6.99.3
• EC 7.1.1.2
• MGC26839
• mitochondrial NADH-ubiquinone oxidoreductase 75 kDa subunit
• NADH dehydrogenase (ubiquinone) Fe-S protein 1 (75kD) (NADH-coenzyme Qreductase)
• NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Qreductase)
• NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
• Ndufs1
• PRO1304

Background

Ndufs1 is encoded by this gene belongs to the complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This protein is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized. Mutations in this gene are associated with complex I deficiency. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFS1