Ndufs1 Antibody

Images

 
Western Blot: Ndufs1 Antibody [NBP2-56504] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: Ndufs1 Antibody [NBP2-56504] - Staining of human cell line RH-30 shows localization to mitochondria.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ndufs1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: REDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAV
Specificity
Specificity of human Ndufs1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFS1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Ndufs1 Antibody

  • CI-75k
  • CI-75Kd
  • complex I 75kDa subunit
  • complex I, mitochondrial respiratory chain, 75-kD subunit
  • Complex I-75kD
  • EC 1.6.5.3
  • EC 1.6.99.3
  • MGC26839
  • mitochondrial NADH-ubiquinone oxidoreductase 75 kDa subunit
  • NADH dehydrogenase (ubiquinone) Fe-S protein 1 (75kD) (NADH-coenzyme Qreductase)
  • NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Qreductase)
  • NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
  • PRO1304

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33074
Species: Hu, Mu
Applications: WB, IHC, IHC-P, KO
NBP1-31465
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49846
Species: Hu
Applications: WB, PEP-ELISA
NBP2-46127
Species: Hu
Applications: WB, IHC
NBP1-85620
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-75587
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84475
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93442
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, Flow-CS, Flow-IC
NBP1-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59305
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82662
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-49831
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-86899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for Ndufs1 Antibody (NBP2-56504) (0)

There are no publications for Ndufs1 Antibody (NBP2-56504).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ndufs1 Antibody (NBP2-56504) (0)

There are no reviews for Ndufs1 Antibody (NBP2-56504). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ndufs1 Antibody (NBP2-56504) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Ndufs1 Products

Bioinformatics Tool for Ndufs1 Antibody (NBP2-56504)

Discover related pathways, diseases and genes to Ndufs1 Antibody (NBP2-56504). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ndufs1 Antibody (NBP2-56504)

Discover more about diseases related to Ndufs1 Antibody (NBP2-56504).
 

Pathways for Ndufs1 Antibody (NBP2-56504)

View related products by pathway.

PTMs for Ndufs1 Antibody (NBP2-56504)

Learn more about PTMs related to Ndufs1 Antibody (NBP2-56504).
 

Research Areas for Ndufs1 Antibody (NBP2-56504)

Find related products by research area.

Blogs on Ndufs1

There are no specific blogs for Ndufs1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ndufs1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFS1