NDUFB7 Antibody - BSA Free

Western Blot: NDUFB7 Antibody [NBP1-88938] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).

Immunohistochemistry-Paraffin: NDUFB7 Antibody [NBP1-88938] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Western Blot: NDUFB7 Antibody [NBP1-88938] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NDUFB7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NDUFB7 Antibody - BSA Free (NBP1-88938) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFB7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NDUFB7 Protein (NBP1-88938PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NDUFB7 Antibody - BSA Free

• B18
• Cell adhesion protein SQM1
• CI-B18NADH-ubiquinone oxidoreductase B18 subunit
• complex I B18 subunit
• Complex I-B18
• MGC2480
• NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7 (18kD, B18)
• NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa
• NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7

Background

NDUFB7 is encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFB7