NDUFB7 Antibody

Images

 
Western Blot: NDUFB7 Antibody [NBP1-88938] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat ...read more
Immunohistochemistry-Paraffin: NDUFB7 Antibody [NBP1-88938] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Western Blot: NDUFB7 Antibody [NBP1-88938] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDUFB7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFB7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NDUFB7 Protein (NBP1-88938PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDUFB7 Antibody

  • B18
  • Cell adhesion protein SQM1
  • CI-B18NADH-ubiquinone oxidoreductase B18 subunit
  • complex I B18 subunit
  • Complex I-B18
  • MGC2480
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7 (18kD, B18)
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa
  • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-66995
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB943
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB1936
Species: Hu
Applications: IP, WB
NB100-64775
Species: Pm, Bv, Hu, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), IP
NBP3-15896
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP1-59069
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
210-TA/CF
Species: Hu
Applications: BA
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-33626
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89985
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
MAB140
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
NBP1-83552
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00003703-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
NBP2-73857
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
AF6457
Species: Hu
Applications: WB

Publications for NDUFB7 Antibody (NBP1-88938) (0)

There are no publications for NDUFB7 Antibody (NBP1-88938).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFB7 Antibody (NBP1-88938) (0)

There are no reviews for NDUFB7 Antibody (NBP1-88938). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFB7 Antibody (NBP1-88938) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFB7 Products

Bioinformatics Tool for NDUFB7 Antibody (NBP1-88938)

Discover related pathways, diseases and genes to NDUFB7 Antibody (NBP1-88938). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFB7 Antibody (NBP1-88938)

Discover more about diseases related to NDUFB7 Antibody (NBP1-88938).
 

Pathways for NDUFB7 Antibody (NBP1-88938)

View related products by pathway.

PTMs for NDUFB7 Antibody (NBP1-88938)

Learn more about PTMs related to NDUFB7 Antibody (NBP1-88938).
 

Research Areas for NDUFB7 Antibody (NBP1-88938)

Find related products by research area.

Blogs on NDUFB7

There are no specific blogs for NDUFB7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFB7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFB7