Recombinant Human NDUFB10 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NDUFB10 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 73 - 172 of Human NDUFB10 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NDUFB10
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NDUFB10 Protein

  • CI-PDSW
  • complex I PDSW subunit
  • Complex I-PDSW
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10 (22kD, PDSW)
  • NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa
  • NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
  • NADH ubiquinone oxidoreductase PDSW subunit (RH 16p13.3)
  • NADH-ubiquinone oxidoreductase PDSW subunit
  • PDSW

Background

NDUFB10 - NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03891
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-695
Species: Hu, Mu, Rt, Po, Av, Bv, Fi, Gt, Ma, Re
Applications: WB, ELISA, IHC
NB100-106
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-02654
Species: Hu, Rt
Applications: WB, Flow, ICC/IF
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-80786
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-84948
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37945
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02158
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22166
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-93442
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004716-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for NDUFB10 Partial Recombinant Protein (H00004716-Q01) (0)

There are no publications for NDUFB10 Partial Recombinant Protein (H00004716-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFB10 Partial Recombinant Protein (H00004716-Q01) (0)

There are no reviews for NDUFB10 Partial Recombinant Protein (H00004716-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFB10 Partial Recombinant Protein (H00004716-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NDUFB10 Products

Bioinformatics Tool for NDUFB10 Partial Recombinant Protein (H00004716-Q01)

Discover related pathways, diseases and genes to NDUFB10 Partial Recombinant Protein (H00004716-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFB10 Partial Recombinant Protein (H00004716-Q01)

Discover more about diseases related to NDUFB10 Partial Recombinant Protein (H00004716-Q01).
 

Pathways for NDUFB10 Partial Recombinant Protein (H00004716-Q01)

View related products by pathway.

PTMs for NDUFB10 Partial Recombinant Protein (H00004716-Q01)

Learn more about PTMs related to NDUFB10 Partial Recombinant Protein (H00004716-Q01).
 

Research Areas for NDUFB10 Partial Recombinant Protein (H00004716-Q01)

Find related products by research area.

Blogs on NDUFB10

There are no specific blogs for NDUFB10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

OGG1 Antibody
NB100-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NDUFB10 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFB10