NDUFA8 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NDUFA8 Antibody [NBP1-82662] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.

Staining of human gastrointestinal, heart muscle, liver and skeletal muscle using NBP1-82662 (A) shows similar protein distribution across tissues to independent antibody NBP1-82661 (B).

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NDUFA8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NDUFA8 Antibody - BSA Free (NBP1-82662) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCA
• Predicted Species: Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFA8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NDUFA8 Protein (NBP1-82662PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NDUFA8 Antibody - BSA Free

• CI-19KD
• CI-PGIV
• complex I PGIV subunit
• Complex I-19kD
• Complex I-PGIV
• MGC793
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8 (19kD, PGIV)
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa
• NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
• NADH:ubiquinone oxidoreductase PGIV subunit
• NADH-ubiquinone oxidoreductase 19 kDa subunit
• PGIV

Background

NDUFA8 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Mammalian complex I is composed of 45 different subunits and transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFA8